[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55806.1
DDBJ      :             Electron transfer flavoprotein alpha subunit
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  544/915 : Eukaryota  168/199 : Viruses  0/175   --->[See Alignment]
c.132.1c.26.2c.31.1
:296 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   79->295 1efpA PDBj 3e-23 31.5 %
:RPS:PDB   52->295 2a1uA PDBj 1e-18 29.6 %
:RPS:SCOP  41->105 1rqpA2  c.132.1.1 * 9e-04 15.6 %
:RPS:SCOP  175->295 1efpA2  c.31.1.2 * 4e-38 39.2 %
:HMM:SCOP  2->172 1efvA1 c.26.2.3 * 5e-15 28.1 %
:HMM:SCOP  173->295 1o97D2 c.31.1.2 * 2.3e-41 45.9 %
:RPS:PFM   175->258 PF00766 * ETF_alpha 1e-12 39.8 %
:HMM:PFM   174->259 PF00766 * ETF_alpha 8.4e-30 40.0 85/86  
:HMM:PFM   5->139 PF01012 * ETF 3.6e-11 29.6 135/164  
:BLT:SWISS 4->296 YDIR_ECOLI 5e-46 36.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55806.1 GT:GENE ACV55806.1 GT:PRODUCT Electron transfer flavoprotein alpha subunit GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2166836..2167726 GB:FROM 2166836 GB:TO 2167726 GB:DIRECTION + GB:PRODUCT Electron transfer flavoprotein alpha subunit GB:NOTE PFAM: Electron transfer flavoprotein alpha subunit ; Electron transfer flavoprotein alpha/beta-subunit; KEGG: slo:Shew_2678 electron transfer flavoprotein, alpha subunit GB:PROTEIN_ID ACV55806.1 GB:DB_XREF GI:257475486 InterPro:IPR014730 InterPro:IPR014731 LENGTH 296 SQ:AASEQ MKAFVIAETADAQKELCAGARTLADEVLLVSIGSAPRTGVADKAYAVELPQGELVENAYDAVAALYDEVAPNTVLFEPTPRLKIVGGRLAAHADASVMCDVTALDGAEAESLYFGGLATKRQRAVGPVAFYSCSGTAFDGIEASGTDVVEERAFVAPQKPLKLRGTHEVPHAGTDLSRASVIVGAGRGFAHEEDLELARSLASAVHGELACSRPLAENEKWLPKNTYLGVSGRMVSPKVYFAVGISGQMQHMIGVHNADVVVAVNKDQNAPVFAQADYGLVADLHEALPALVEKLS GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 4->296|YDIR_ECOLI|5e-46|36.5|285/312| BL:PDB:NREP 1 BL:PDB:REP 79->295|1efpA|3e-23|31.5|216/307| RP:PDB:NREP 1 RP:PDB:REP 52->295|2a1uA|1e-18|29.6|243/315| RP:PFM:NREP 1 RP:PFM:REP 175->258|PF00766|1e-12|39.8|83/86|ETF_alpha| HM:PFM:NREP 2 HM:PFM:REP 174->259|PF00766|8.4e-30|40.0|85/86|ETF_alpha| HM:PFM:REP 5->139|PF01012|3.6e-11|29.6|135/164|ETF| RP:SCP:NREP 2 RP:SCP:REP 41->105|1rqpA2|9e-04|15.6|64/185|c.132.1.1| RP:SCP:REP 175->295|1efpA2|4e-38|39.2|120/124|c.31.1.2| HM:SCP:REP 2->172|1efvA1|5e-15|28.1|171/188|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 173->295|1o97D2|2.3e-41|45.9|122/0|c.31.1.2|1/1|DHS-like NAD/FAD-binding domain| OP:NHOMO 1204 OP:NHOMOORG 742 OP:PATTERN 22----2222222222-22322212112-111-----------------------------3322--- 1232211111111111111-11111111111111111121111111-11---111112--11211111121--------152------11111111---111111111-1---------------1111111112111122---12-------11-----------1----------------11111--112111111-1111111111111111111131111------21----------------------1--------11---------------------------------------------------------1532555555554541433422215-3-1-12-973463-141--11-3-12-11111111132222111222221111111111112222242212113112334335232411111111111112222222212212322-----------------------------1121113321222233422222223722221245612121112261222231213111-112111111111---14115422----------7471915--11211114-------------------------1111-1112121-1111111311112132121-----1-------2-1-1--3332333332-2333333333233333331-------13231333332313113-2213222-----------------1111111111-1124---------------11111111114122222222222221223-------------1-----11-1111111111111111--12111111----------1-------------------------11111121111-- ----111-211-11111111111111111111111111111111111-111111111-1111111111--1111111111111111-1-12111111111111112-11121211-11-11-1111-1-221-12211--1-11111-1-11-2121-11211211121131111111-----1111321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 93.2 SQ:SECSTR ####################TTcccEEEEEEEcHHHHHHHccEEEEEEcccTccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHTcccEEEEcEEEETEEEEEETTTTEEEEEEcccccEEEEEcGGGcccccccccccEEEEcccccccccccccccccccccccTTTccEEEEEcGGGccTTTTHHHHHHHHHHTcEEEEcHHHHHHTTcccGGGcccTTcccccccEEEEEcccccHHHHTTTTTccEEEEEEccTTcGGGGTccEEEEccHHHHHHHHHHHHc PSIPRED cEEEEEEEcccHHHHHHHHHHHHccEEEEEEEccccccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEcccEEEEEEEcccEEEEEEcccccccccccccccEEEEEcccccccEEEEEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHHHHccEEEEcHHHHcccccccHHHEEcccccEEccEEEEEEEEcccHHHHHccccccEEEEEEccccccHHccccEEEEccHHHHHHHHHHHHc //