[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55828.1
DDBJ      :             thioesterase superfamily protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->66 1wluA PDBj 5e-06 38.8 %
:RPS:PDB   14->136 3dkzA PDBj 2e-15 18.6 %
:RPS:SCOP  19->136 1zkiA1  d.38.1.5 * 1e-17 24.8 %
:HMM:SCOP  11->136 1zkiA1 d.38.1.5 * 1.1e-32 36.8 %
:HMM:PFM   52->128 PF03061 * 4HBT 2.9e-15 44.2 77/79  
:HMM:PFM   12->42 PF04769 * MAT_Alpha1 3.4e-05 41.9 31/200  
:BLT:SWISS 12->87 ACO13_PONAB 4e-05 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55828.1 GT:GENE ACV55828.1 GT:PRODUCT thioesterase superfamily protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2193077..2193562) GB:FROM 2193077 GB:TO 2193562 GB:DIRECTION - GB:PRODUCT thioesterase superfamily protein GB:NOTE PFAM: thioesterase superfamily protein; KEGG: dal:Dalk_3864 thioesterase superfamily protein GB:PROTEIN_ID ACV55828.1 GB:DB_XREF GI:257475508 InterPro:IPR003736 InterPro:IPR006683 LENGTH 161 SQ:AASEQ MAQVNPRHVDAVMELINRSPYFELLGIRLTALSEGACTVEAVLERKHLNAFGGAHGGAYASLLDCAAYWALYCSLDEDEGFTTVDLNASNLRASGPGLVVVEGRVVKRGRTMCLCEAELRDAEGRLLAHATSKMLVGAHLQPMSAAVRELGAGALPPKFLA GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 12->87|ACO13_PONAB|4e-05|36.0|75/140| SEG 97->110|glvvvegrvvkrgr| BL:PDB:NREP 1 BL:PDB:REP 18->66|1wluA|5e-06|38.8|49/117| RP:PDB:NREP 1 RP:PDB:REP 14->136|3dkzA|2e-15|18.6|118/121| HM:PFM:NREP 2 HM:PFM:REP 52->128|PF03061|2.9e-15|44.2|77/79|4HBT| HM:PFM:REP 12->42|PF04769|3.4e-05|41.9|31/200|MAT_Alpha1| RP:SCP:NREP 1 RP:SCP:REP 19->136|1zkiA1|1e-17|24.8|117/126|d.38.1.5| HM:SCP:REP 11->136|1zkiA1|1.1e-32|36.8|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 36 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------11111111111111-111111111-1----111--1---------------1---------------3---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 95.0 SQ:SECSTR ##ccccccTHHHHcccccccHHHHHTcEEEEEETTEEEEEEccccTTccccccccHHHHHHHHHHHHHTTTTTTccccTTccEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEETTccEEEEEEEEEEEccccccccHHHHHH###ccccG### DISOP:02AL 161-162| PSIPRED cccccHHHHHHHHHHccccHHHHHcccEEEEEEccEEEEEEEccHHHHccccEEEHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEEcccccccHHHHHHcccccccccccc //