[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55832.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  54/68 : Bacteria  523/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:206 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->206 2vpyB PDBj 2e-28 36.9 %
:RPS:PDB   60->120 1bc6A PDBj 2e-09 31.7 %
:RPS:PDB   92->186 1bluA PDBj 2e-06 22.7 %
:RPS:SCOP  1->205 1ti2B2  d.58.1.5 * 1e-47 30.6 %
:HMM:SCOP  1->204 1q16B_ d.58.1.5 * 8.4e-67 46.1 %
:HMM:PFM   7->23 PF00037 * Fer4 1e-07 41.2 17/24  
:HMM:PFM   72->81 PF00037 * Fer4 0.00086 80.0 10/24  
:HMM:PFM   90->112 PF00037 * Fer4 4e-11 47.8 23/24  
:BLT:SWISS 6->203 HMEA_ARCFU 4e-35 46.5 %
:PROS 97->108|PS00198|4FE4S_FER_1
:REPEAT 3|11->41|95->122|141->178

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55832.1 GT:GENE ACV55832.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2196764..2197384) GB:FROM 2196764 GB:TO 2197384 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: scl:sce4705 molybdopterin oxidoreductase, iron-sulfur binding subunit GB:PROTEIN_ID ACV55832.1 GB:DB_XREF GI:257475512 InterPro:IPR000813 InterPro:IPR001450 InterPro:IPR017900 LENGTH 206 SQ:AASEQ MTKLGIAINLERCVGCNTCANACKMQNNIPMNMLYIRVETDGVDTADGAQGTYPDLSRTYIPVACQHCENPACLKVCPVGATYKDDMGRVEIHYDKCIGCRICMAACPYNARVFNWNEPERDPNWNYGDKDVPVRPKGVAEKCTLCKERTDRGDIPMCVRVCPGRARVYGDLDDPESEISKVVRENKAYQLLEEFGTRPQLRYYNA GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 6->203|HMEA_ARCFU|4e-35|46.5|185/269| PROS 97->108|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 3|11->41|95->122|141->178| BL:PDB:NREP 1 BL:PDB:REP 1->206|2vpyB|2e-28|36.9|179/193| RP:PDB:NREP 2 RP:PDB:REP 60->120|1bc6A|2e-09|31.7|60/77| RP:PDB:REP 92->186|1bluA|2e-06|22.7|75/80| HM:PFM:NREP 3 HM:PFM:REP 7->23|PF00037|1e-07|41.2|17/24|Fer4| HM:PFM:REP 72->81|PF00037|0.00086|80.0|10/24|Fer4| HM:PFM:REP 90->112|PF00037|4e-11|47.8|23/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 1->205|1ti2B2|1e-47|30.6|183/195|d.58.1.5| HM:SCP:REP 1->204|1q16B_|8.4e-67|46.1|178/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2462 OP:NHOMOORG 580 OP:PATTERN 22121322344333424-5574463113-1131-433333233-1--13-21212-15251---3--- -7A11111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6cS334222---------1111111111111---------------224333333234442233314----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------133-11111111-1-1411-111--1--9--13pl3345-59A1113---1631--1------21--423-31--11111111112-2242232511----------1-1121-11212-1--31211111111311--7-3-------------------------------111-122-3211212233333323444413222334211232241443325213124-1-23----------B3418A557A989A88D178697693-BABA353427422112211-2-------2B3321174-111-----45886-5G9A9787BA8J8---1842------B6D9AA-GHHFGFEEGG-GGFHGFFGFGHFGFGGFFA99A9621CHDGGHHHHHHGFHFGG79CBEDEF--555555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------11--1-111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 100.0 SQ:SECSTR cccEEEEEccGGccccccccTTcccTTccccTcccETTccccccccccHHHHHHHHHHHEcccTTTTccccccTTTcTTccEEEcccccEEEcTTTccccccHHHHcGGGccEETTTccHHHHccEEEEcTcccGccGGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGcccccEEcccEccccccEEEccEEEEcc PSIPRED ccEEEEEEEHHHcccccHHHHHHHHHHccccccEEEEEEEcccccccccccccccccEEEEEEEccccccccccEEcccccEEEcccccEEEcHHHcccccccHHccccccEEEEccccccccHHccccccccccccEEEEEccccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHHcccEEccHHHcccccEEEEcc //