[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55841.1
DDBJ      :             acetolactate synthase, large subunit, biosynthetic type
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  764/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
c.31.1c.36.1c.92.2
:636 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->598 3ea4A PDBj e-132 46.9 %
:RPS:PDB   43->578 1bfdA PDBj e-124 22.9 %
:RPS:SCOP  37->560 1fp4B  c.92.2.3 * 1e-83 11.3 %
:HMM:SCOP  30->224 1ybhA2 c.36.1.5 * 2e-61 45.3 %
:HMM:SCOP  222->395 1jscA1 c.31.1.3 * 1.3e-67 60.2 %
:HMM:SCOP  405->613 2djiA3 c.36.1.9 * 1.6e-68 43.7 %
:RPS:PFM   41->207 PF02776 * TPP_enzyme_N 2e-41 50.3 %
:RPS:PFM   231->363 PF00205 * TPP_enzyme_M 1e-35 59.4 %
:RPS:PFM   443->577 PF02775 * TPP_enzyme_C 2e-23 42.2 %
:HMM:PFM   42->206 PF02776 * TPP_enzyme_N 4.8e-60 49.1 165/172  
:HMM:PFM   431->578 PF02775 * TPP_enzyme_C 6.2e-53 44.9 147/150  
:HMM:PFM   231->363 PF00205 * TPP_enzyme_M 4.6e-50 55.6 133/137  
:BLT:SWISS 41->598 ILVB_MYCTU e-160 53.1 %
:PROS 467->486|PS00187|TPP_ENZYMES
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55841.1 GT:GENE ACV55841.1 GT:PRODUCT acetolactate synthase, large subunit, biosynthetic type GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2206772..2208682) GB:FROM 2206772 GB:TO 2208682 GB:DIRECTION - GB:PRODUCT acetolactate synthase, large subunit, biosynthetic type GB:NOTE TIGRFAM: acetolactate synthase, large subunit, biosynthetic type; PFAM: thiamine pyrophosphate protein TPP binding domain protein; thiamine pyrophosphate protein domain protein TPP-binding; thiamine pyrophosphate protein central region; KEGG: pca:Pcar_1910 acetolactate synthase, large subunit, biosynthetic type GB:PROTEIN_ID ACV55841.1 GB:DB_XREF GI:257475521 InterPro:IPR000399 InterPro:IPR011766 InterPro:IPR012000 InterPro:IPR012001 InterPro:IPR012846 LENGTH 636 SQ:AASEQ MTNARSTSTDDAAPRPTQANATAAGASRGLGSRTPKQGATMIGAEAVVASLEAEGVDLVFGYPGGQAIKIYDALYDSAQIKHVLARHEQGAVHEADGYARATGNVGVAIVTSGPGATNTVTGIATAYMDSVPLVVITGQVPRGVIGTDSFQESDIVGITMPVVKHSYLLQSTDELTRTFREAFHIAKTGRPGPVLIDIPSDLASERMVFDYPDDVNLPSYKPTYRGNAKQIKQAVARIARAERPVLYVGGGTVSSGASEELRELAELMQIPVVTTLMGKGAFPASHQLNLGPVGMHGSKYANLAMTESDLLIAAGARFSDRVTGKLDEFAPHADVIHIDIDPAEIGKVREVQVPIVGDLKGVLGGIVASLRKEGARPNTGDWVAQISAWRTRYPFYHPGVGDDPDEIVPEVVLKKLSELLDPQKSVVVTEVGQHQMWAAQSVDREAPRSFISSGGLGTMGFGFPAAIGAAIGCPDKQVVCVAGDGSFQMNSQEMATAGIHRVPVKVLILDNRCLGMVHQWQKLFYDERYSSTLLDANPDFVKLADAYGWQAERVEKPADVEAALERMLASDGPYLLDVAISRDQNVYPMVAPGRALDEVIGAIDVAVGAVRTDVPEGDEIDAADEVDENDEKGGAR GT:EXON 1|1-636:0| BL:SWS:NREP 1 BL:SWS:REP 41->598|ILVB_MYCTU|e-160|53.1|554/618| PROS 467->486|PS00187|TPP_ENZYMES|PDOC00166| SEG 460->472|gfgfpaaigaaig| SEG 599->610|vigaidvavgav| BL:PDB:NREP 1 BL:PDB:REP 43->598|3ea4A|e-132|46.9|546/581| RP:PDB:NREP 1 RP:PDB:REP 43->578|1bfdA|e-124|22.9|515/523| RP:PFM:NREP 3 RP:PFM:REP 41->207|PF02776|2e-41|50.3|167/170|TPP_enzyme_N| RP:PFM:REP 231->363|PF00205|1e-35|59.4|133/138|TPP_enzyme_M| RP:PFM:REP 443->577|PF02775|2e-23|42.2|135/139|TPP_enzyme_C| HM:PFM:NREP 3 HM:PFM:REP 42->206|PF02776|4.8e-60|49.1|165/172|TPP_enzyme_N| HM:PFM:REP 431->578|PF02775|6.2e-53|44.9|147/150|TPP_enzyme_C| HM:PFM:REP 231->363|PF00205|4.6e-50|55.6|133/137|TPP_enzyme_M| GO:PFM:NREP 5 GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02776|IPR012001| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00205|IPR012000| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF00205|IPR012000| GO:PFM GO:0003824|"GO:catalytic activity"|PF02775|IPR011766| GO:PFM GO:0030976|"GO:thiamin pyrophosphate binding"|PF02775|IPR011766| RP:SCP:NREP 1 RP:SCP:REP 37->560|1fp4B|1e-83|11.3|497/522|c.92.2.3| HM:SCP:REP 30->224|1ybhA2|2e-61|45.3|192/0|c.36.1.5|1/2|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 222->395|1jscA1|1.3e-67|60.2|171/0|c.31.1.3|1/1|DHS-like NAD/FAD-binding domain| HM:SCP:REP 405->613|2djiA3|1.6e-68|43.7|206/0|c.36.1.9|2/2|Thiamin diphosphate-binding fold (THDP-binding)| OP:NHOMO 3381 OP:NHOMOORG 1004 OP:PATTERN 11-1--6765566674-31221143--21122243222222221312213343211-----2421-11 4371842222223256944-44336D444445455555EF2225233-232196754311535255D98621222111-211811111223112--111-1111142211---------------21111111111222221111932523432211113111222233821111111211111211111-124555554571465536334434545235242-4444432534444444444444434444122145112-27622553331344231112---22222222222222-------------211222111122135-------5-42133111-112--2122165222121221112--1-112223-11-134CBB2148457633333332316-66955A59772-644347B775896414168942357675555555542212333-----------------------------3336226DA8899AAA976666BBDE999958A8I78A824654333228355B73333111311111111112422-A22312334333412213112433323353621111111111-1-------1111221322231312222332422322222323233-1-311111111155553655666576766-6646767656666665664777763357566556667667664965666651-75555554555511---1---223332762222222-22213222333332312442A99949464588633332----1---313253333322222332222222211111111331132------------------------111----------11--1-111122 --1122--21----254435555A8882222323332424244355222433551124212143421611562425633643231233-23242221111112522-24-42322231-11121242618I2-32411112-25212112211421113374163211122235121118111236126364223111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 601 STR:RPRED 94.5 SQ:SECSTR ##################################ccTTcEEEHHHHHHHHHHHTTccEEEEcccGGGHHHHTTccTTcTcEEEEcccHHHHHHHHHHHHHHHTccEEEEEEHHHHHHHTHHHHHHHHHHTccEEEEEEEccHHHHTTTTTccTTGGGTTTTcccEEEccccGGGHHHHHHHHHHHHHccccccEEEEEEGGGTcTccccGGGGGGTTccccccccccHHHHHHHHHHHHHccccEEEEcHHHHHHTcHHHHHHHHHHHTccEEccccccccccTTcTTEEEEcccGcHHHHHHHHTTccEEEEEcccTTcccccccccccTTcEEEEEEccHHHHHHcccccEEEEccHHHHHHHHHHHHHTTHHHHHHcccccccccccccccccccTTccccccccHHHHHHHHHHHcccTTcEEEEEcGGGHHHHHHHcccccTTcEEEcTTccccccHHHHHHHHHHHcTTccEEEEEEHHHHTTTGGGHHHHHHHTcccEEEEEEccccHHHHHHHHHTTccccccccccccccHHHHHHHTTcEEEEEccHHHHHHHHHHHHHccccEEEEEEcccccccTTTTcTTccGGGHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 636-637| PSIPRED ccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEccccHHHccccccccccHHHHHHHHcEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEcccHHccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHcccEEEcHHHccccccccccccccccccccHHHHHHHHHccEEEEEccccccccccccccccccccEEEEEccHHHccccccccccEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHccccccccccccHHHHHHHHHHHccccccEEEcccccHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHcHHHHHHHHHccccEEEEEEEccccHHHHHHHHHccccccccccccccccHHHHHHHcccEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHHcccccHHcccccccccccccccHHHHHHHcHHHHccc //