[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55845.1
DDBJ      :             NusG antitermination factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.42
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   56->155 2ckkA PDBj 3e-04 14.9 %
:RPS:SCOP  9->101 1nz8A  d.58.42.1 * 8e-06 22.6 %
:HMM:SCOP  5->113 1nz8A_ d.58.42.1 * 3.2e-08 19.3 %
:HMM:PFM   9->88 PF02357 * NusG 9.1e-09 27.0 74/92  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55845.1 GT:GENE ACV55845.1 GT:PRODUCT NusG antitermination factor GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2212445..2212966) GB:FROM 2212445 GB:TO 2212966 GB:DIRECTION - GB:PRODUCT NusG antitermination factor GB:NOTE PFAM: NGN domain protein GB:PROTEIN_ID ACV55845.1 GB:DB_XREF GI:257475525 InterPro:IPR006645 LENGTH 173 SQ:AASEQ MPSRGRARYVLQVVPGRERAVAERVKALAGPELVRDCFALSYCILKKNQGVWRLLTETMFPGYLFVASDDIEAFEKTIKRSTAFARLLGAERRAFALRPEEASFVHDFGGPSHVVGFSRGTIDNGRTIIDEGPLRGHVDRIKKIDRHKRIAYLDIGLLDQKQVRVGLEIVRKT GT:EXON 1|1-173:0| RP:PDB:NREP 1 RP:PDB:REP 56->155|2ckkA|3e-04|14.9|94/120| HM:PFM:NREP 1 HM:PFM:REP 9->88|PF02357|9.1e-09|27.0|74/92|NusG| RP:SCP:NREP 1 RP:SCP:REP 9->101|1nz8A|8e-06|22.6|93/119|d.58.42.1| HM:SCP:REP 5->113|1nz8A_|3.2e-08|19.3|109/0|d.58.42.1|1/1|N-utilization substance G protein NusG, N-terminal domain| OP:NHOMO 9 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------41-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------1---------1-------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 54.3 SQ:SECSTR #######################################################ccccccTTcEEEEcccTTcGGGTTcEEEEEEEETTTEEEEEETTTc###cEEEEEGGGEEEcc###ccTTcEEEEccTTTTcEEEEEEEEGGGTEEEEEE################## DISOP:02AL 173-174| PSIPRED ccccccEEEEEEEccccHHHHHHHHHHHHcccccEEEEcccEEEEEEEccEEEEEEEEccccEEEEEEEEccccEEEEEccccEEEEEccccccccccHHHHHHHHHHcccccccccccccccccEEEEEEccccccEEEEEEEEccccEEEEEEEEccccEEEccccEEEEc //