[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55863.1
DDBJ      :             protein of unknown function DUF74
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  257/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.230.5
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->102 1y2iA PDBj 6e-26 56.1 %
:RPS:SCOP  1->104 1vr4A1  d.230.5.1 * 7e-31 50.5 %
:HMM:SCOP  1->108 1y2iA_ d.230.5.1 * 2.5e-38 51.9 %
:RPS:PFM   2->104 PF01906 * DUF74 4e-25 59.2 %
:HMM:PFM   1->105 PF01906 * DUF74 2.3e-44 52.4 105/105  
:BLT:SWISS 1->104 Y562_BIFLO 2e-39 69.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55863.1 GT:GENE ACV55863.1 GT:PRODUCT protein of unknown function DUF74 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2230840..2231163) GB:FROM 2230840 GB:TO 2231163 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF74 GB:NOTE PFAM: protein of unknown function DUF74; KEGG: dac:Daci_3728 hypothetical protein GB:PROTEIN_ID ACV55863.1 GB:DB_XREF GI:257475543 InterPro:IPR002765 LENGTH 107 SQ:AASEQ MIVTTTPSVEGYRITGYYGIVFGEVITGINFLRDFGAGIRNIVGGRSEGYEQELLQTRNEALQELEQRAASMGAHAVVGVDMDYEVLGQGNMLMVTASGTAVTLEQA GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 1->104|Y562_BIFLO|2e-39|69.2|104/110| TM:NTM 1 TM:REGION 13->35| BL:PDB:NREP 1 BL:PDB:REP 4->102|1y2iA|6e-26|56.1|98/106| RP:PFM:NREP 1 RP:PFM:REP 2->104|PF01906|4e-25|59.2|103/105|DUF74| HM:PFM:NREP 1 HM:PFM:REP 1->105|PF01906|2.3e-44|52.4|105/105|DUF74| RP:SCP:NREP 1 RP:SCP:REP 1->104|1vr4A1|7e-31|50.5|103/103|d.230.5.1| HM:SCP:REP 1->108|1y2iA_|2.5e-38|51.9|108/0|d.230.5.1|1/1|YbjQ-like| OP:NHOMO 313 OP:NHOMOORG 275 OP:PATTERN ----1-----------11-----------1--111-1------11-1--------1---11-1----- --111------11-----------1------1--------1--------------------------111-----111--11---1--1111-1-------------1-1-------------------------------111-11--1---11------1-11-11111---------------2211--11122233221242323-2----423-111---11111122--------------------1-1-11--1-111--1111---1111--------------------------------------------1----1111111111-111-11-1-1--1---1111112--1----1--1--1111---------1----------------------------1-------------------113-11111111-------------121------------------------------1--1--------------------------------------------1---------------------1-111---------------------1------------------------------------2212-1--1-111------1-------------------------1111-111111111111-1111111111111111111---11---111111111111111111111111----------------11-----------1--111-1-1-------1------1---------111--1111-----------------11111111111----------------------------------1-------------------------1--1111111--- --------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 97.2 SQ:SECSTR cEEccccccTTEEEEEEEEEEEEEEEEcHHHHHHHTTTccccccTTTcTHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEEEEEcTGTccEEEEEEEEEEc### DISOP:02AL 106-108| PSIPRED cEEEcccccccEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHcccccEEEEEEEEEEEEEEEc //