[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55867.1
DDBJ      :             transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6
:196 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   138->186 1fseE PDBj 1e-07 40.8 %
:RPS:PDB   138->188 3cloA PDBj 3e-12 33.3 %
:RPS:SCOP  138->192 1h0mA1  a.4.6.2 * 8e-12 30.9 %
:HMM:SCOP  116->195 1p4wA_ a.4.6.2 * 4.9e-15 36.2 %
:RPS:PFM   138->189 PF00196 * GerE 1e-06 46.2 %
:HMM:PFM   137->189 PF00196 * GerE 2.1e-17 43.4 53/58  
:BLT:SWISS 132->190 MALT_SALTY 8e-08 39.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55867.1 GT:GENE ACV55867.1 GT:PRODUCT transcriptional regulator, LuxR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2234860..2235450) GB:FROM 2234860 GB:TO 2235450 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LuxR family GB:NOTE PFAM: regulatory protein LuxR; SMART: regulatory protein LuxR; KEGG: bcj:BCAL1381 LuxR superfamily regulatory protein GB:PROTEIN_ID ACV55867.1 GB:DB_XREF GI:257475547 InterPro:IPR000792 LENGTH 196 SQ:AASEQ MVSWLTVAVLALTCVVYAAFCAAVVRAFFRTRVNRTAYRAAGAWAACFGVTLVGSLMALDTRGVDAAATFAACACLLSFPSCLLLERRWRNRDMAAAVAYLQLHRPAPRPATPAAAPGSEWGTGLDATCARLARSYDLTRREEDVLRLLMEGRTFAEAADELVVSLNTVKSHVRRIYAKMGVNGKADLLEKVSSAI GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 132->190|MALT_SALTY|8e-08|39.0|59/901| TM:NTM 3 TM:REGION 6->28| TM:REGION 38->60| TM:REGION 65->86| SEG 5->46|ltvavlaltcvvyaafcaavvraffrtrvnrtayraagawaa| SEG 66->75|aaatfaacac| SEG 105->117|rpaprpatpaaap| BL:PDB:NREP 1 BL:PDB:REP 138->186|1fseE|1e-07|40.8|49/64| RP:PDB:NREP 1 RP:PDB:REP 138->188|3cloA|3e-12|33.3|51/249| RP:PFM:NREP 1 RP:PFM:REP 138->189|PF00196|1e-06|46.2|52/57|GerE| HM:PFM:NREP 1 HM:PFM:REP 137->189|PF00196|2.1e-17|43.4|53/58|GerE| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 1 RP:SCP:REP 138->192|1h0mA1|8e-12|30.9|55/65|a.4.6.2| HM:SCP:REP 116->195|1p4wA_|4.9e-15|36.2|80/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 31 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------3L5----------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 36.7 SQ:SECSTR ############################################################################################################################HHHHHHHHTGGcTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHEHTT PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHcccccHHHccccHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcc //