[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55872.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   86->140 PF03833 * PolC_DP2 0.00093 27.8 54/900  
:BLT:SWISS 95->137 Y416_METJA 2e-05 37.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55872.1 GT:GENE ACV55872.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2239694..2240245) GB:FROM 2239694 GB:TO 2240245 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: sus:Acid_2323 hypothetical protein GB:PROTEIN_ID ACV55872.1 GB:DB_XREF GI:257475552 LENGTH 183 SQ:AASEQ MSELLNQLWTPELQAAFTVVVVLLVILYVLSIVWVVRDAYLRGSYWYVWAIVALVPLLGIIAYCLLRPPLLQIDRDEQELEIALKQRELMKYGECANCGYPVEADFVLCPNCHQRLKNLCGTCNHALDPTWTVCPYCATPVAGGPRTRRAPQQRGARTQQPQQAATQQQTRQARPAQSEHGVQ GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 95->137|Y416_METJA|2e-05|37.2|43/190| TM:NTM 2 TM:REGION 13->35| TM:REGION 48->70| SEG 19->36|vvvvllvilyvlsivwvv| SEG 143->177|ggprtrrapqqrgartqqpqqaatqqqtrqarpaq| HM:PFM:NREP 1 HM:PFM:REP 86->140|PF03833|0.00093|27.8|54/900|PolC_DP2| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------11111-----------------------------------------------------11111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,25-25,31-31| PSIPRED cHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccccccHHccccccccccccccccccccccccccccccccEEcccccccccccccccHHHHHHHHcccHHHHcccc //