[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55885.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->68 1y7yB PDBj 4e-11 41.9 %
:RPS:PDB   8->70 3clcA PDBj 2e-10 38.1 %
:RPS:SCOP  3->77 1y9qA1  a.35.1.8 * 3e-11 26.7 %
:HMM:SCOP  1->79 1y9qA1 a.35.1.8 * 2.5e-14 31.6 %
:RPS:PFM   13->66 PF01381 * HTH_3 7e-06 35.2 %
:HMM:PFM   13->67 PF01381 * HTH_3 1.6e-14 38.2 55/55  
:BLT:SWISS 3->73 MUNC_MYCSP 2e-13 50.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55885.1 GT:GENE ACV55885.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2252845..2253081 GB:FROM 2252845 GB:TO 2253081 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: slo:Shew_3490 XRE family transcriptional regulator GB:PROTEIN_ID ACV55885.1 GB:DB_XREF GI:257475565 InterPro:IPR001387 LENGTH 78 SQ:AASEQ MRNILQIKVGLRIKDLRAVHDVSQERFANKIGMDRTYLASIEVGQRNVTLQNLAKIANGFDMTLSEFFEGIPRVDPNT GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 3->73|MUNC_MYCSP|2e-13|50.7|71/74| BL:PDB:NREP 1 BL:PDB:REP 7->68|1y7yB|4e-11|41.9|62/66| RP:PDB:NREP 1 RP:PDB:REP 8->70|3clcA|2e-10|38.1|63/76| RP:PFM:NREP 1 RP:PFM:REP 13->66|PF01381|7e-06|35.2|54/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 13->67|PF01381|1.6e-14|38.2|55/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 3->77|1y9qA1|3e-11|26.7|75/79|a.35.1.8| HM:SCP:REP 1->79|1y9qA1|2.5e-14|31.6|79/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 14 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------4----------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------------------------------------------------------------------------------1------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1----------------------2--------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHHHHHccc DISOP:02AL 78-79| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccccccccc //