[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55889.1
DDBJ      :             diguanylate cyclase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  617/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.58.29
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   135->297 1w25A PDBj 2e-20 41.1 %
:RPS:PDB   121->294 3breA PDBj 2e-28 29.2 %
:RPS:SCOP  143->294 1w25A3  d.58.29.2 * 6e-27 35.6 %
:HMM:SCOP  142->299 1w25A3 d.58.29.2 * 1.6e-37 35.7 %
:RPS:PFM   140->294 PF00990 * GGDEF 2e-20 48.3 %
:HMM:PFM   137->295 PF00990 * GGDEF 4.2e-37 37.2 156/161  
:BLT:SWISS 135->297 PLED_CAUCR 5e-20 41.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55889.1 GT:GENE ACV55889.1 GT:PRODUCT diguanylate cyclase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2254512..2255411) GB:FROM 2254512 GB:TO 2255411 GB:DIRECTION - GB:PRODUCT diguanylate cyclase GB:NOTE KEGG: smd:Smed_0926 response regulator PleD; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing protein; SMART: GGDEF domain containing protein GB:PROTEIN_ID ACV55889.1 GB:DB_XREF GI:257475569 InterPro:IPR000160 LENGTH 299 SQ:AASEQ MFPYASIHPEVASAATDLLRFDYYRLVDPRDHRVFAYDRDGDRLIEVDGPCYQLWNQDDPCLNCSSRACLTMQDAVFKIEYLDGRVLHVTSVPMDIEGAELVLELIKDVTDSLLVADIEVRDNIEITQMITKFNELAVRDGFTKLYNKTFINNELESLVQAARGGSPAGEAAVVLLDIDGFKQINDTYGHIAGDDALQYFASKMRSFSRSFDGWVGRFGGDEFVLCAPKGLSEGDLERLFAEIDAIERHAFQAEAGSFSLAASCGVCFVRPDDTVRSLLDRADVAMYRAKESGRRWVER GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 135->297|PLED_CAUCR|5e-20|41.1|158/454| BL:PDB:NREP 1 BL:PDB:REP 135->297|1w25A|2e-20|41.1|158/454| RP:PDB:NREP 1 RP:PDB:REP 121->294|3breA|2e-28|29.2|171/322| RP:PFM:NREP 1 RP:PFM:REP 140->294|PF00990|2e-20|48.3|143/160|GGDEF| HM:PFM:NREP 1 HM:PFM:REP 137->295|PF00990|4.2e-37|37.2|156/161|GGDEF| RP:SCP:NREP 1 RP:SCP:REP 143->294|1w25A3|6e-27|35.6|149/162|d.58.29.2| HM:SCP:REP 142->299|1w25A3|1.6e-37|35.7|154/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 7544 OP:NHOMOORG 624 OP:PATTERN -------------------------------------------------------------------- F8228---111---142----D11-1------65557A64988Ma-------635-----852-82D6543---------9156BI66--------------------1----------------11111111131ABB9811174fNREFF123EE---2--7H8-DDF1------------M494386-592777775672777777-23332777487D2GG333332AD---------------------11--------2211---11--1-----------------------------------------------3A94F66666766554D554444649--7A858DEEA3659A422451--8396992-----26UNP85FQKDNQ4587478788J-RMKMJ8IMAR5-GPPMQRMSRVHDRC7E92819678584--------BDD2-e7P11111111111111111111111-11111-86C8398741GEGFHED7776BBQW888827JQPAJDM-2KKFUHYJKQ12i97PPQQGUXZG-------56EIfm4FQGGILN8jTLJL1JGKYDKDXP45548555C673--111-----------SAHOC43URFYYWkJhRcleegcbmYgdeUeaYUTvl---9UBa------BEGA2K7CBBCCCCCDA-ACBDD89BDBBBBBCCBBBBFDDD---8488888777787886B6555458--E34444433444---P-----CEDDC8iDl---------------9899926---DXLLMKRQVTUUSSRMRSU-----2---VHRQOUUTTSUVUjjLKJJJJGDEG1111--Y27755BB11111111515-------------------------7747577777--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----3---------52----------1--8-----6---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 83.9 SQ:SECSTR ###################cccTTcccccccEEEE##EcccccccccEEE###EEEET###############EEEETEEEEEEEcccccGGGccccccccccccccccc#########HHHHHHHHHHHHHHHHHHHccTTTccccHHHHHHHHHHHHHHHHHHHHTccEEEEEEEETTHHHHHHHHcHHHHHHHHHHHHHHHHTTcccTTcEEEEEETTEEEEEEEcTccHHHHHHHHHHHHHHTccEEccccTTEEccEEEEEEcccccccTHHHHHHHHHHHHHHHTTTcccEEc DISOP:02AL 299-300| PSIPRED cccHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEcccccEEccccccHHHHcccccHHccHHHHHHHHccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEcccccEEEEEEEHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHccEEEccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccc //