Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55894.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:HMM:PFM   21->116 PF03899 * ATP_synt_I 0.00062 29.5 95/100  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55894.1 GT:GENE ACV55894.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2262205..2262792 GB:FROM 2262205 GB:TO 2262792 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55894.1 GB:DB_XREF GI:257475574 LENGTH 195 SQ:AASEQ MPQDRTLKAIKSRSRSEQVSVVSLLLLPLLGMCCLLIPDTVTDALPYLLGGLMAVSGAAGLVYAVAHASGARADARRLAEEPAVLGRAVVMCVLGGVILVQGHASISFVGVMWGLLGLYKAADEIDEVVHALKGRRPFALKLAFTVFEMVLAVLLIISPFANIEHHVLLLGLELIAYPFRIESGDSGKLTVETEA GT:EXON 1|1-195:0| TM:NTM 5 TM:REGION 17->39| TM:REGION 47->69| TM:REGION 79->101| TM:REGION 106->128| TM:REGION 149->171| SEG 12->36|srsrseqvsvvsllllpllgmccll| HM:PFM:NREP 1 HM:PFM:REP 21->116|PF03899|0.00062|29.5|95/100|ATP_synt_I| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-26,31-32,34-34,73-74,76-76,109-109,115-116,118-118,123-123,165-165| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHHcEEEEccccccEEEEEEcc //