[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55921.1
DDBJ      :             ybaK/ebsC protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  299/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.116.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->158 2dxaA PDBj 5e-13 43.2 %
:RPS:PDB   9->158 1dbxA PDBj 5e-25 27.2 %
:RPS:SCOP  9->158 1dbuA  d.116.1.1 * 8e-28 29.9 %
:HMM:SCOP  9->160 1wdvA_ d.116.1.1 * 9.5e-37 37.3 %
:RPS:PFM   30->147 PF04073 * YbaK 1e-09 28.8 %
:HMM:PFM   30->149 PF04073 * YbaK 2.3e-26 34.2 120/123  
:BLT:SWISS 3->159 EBSC_ENTFA 3e-21 35.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55921.1 GT:GENE ACV55921.1 GT:PRODUCT ybaK/ebsC protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2296044..2296529 GB:FROM 2296044 GB:TO 2296529 GB:DIRECTION + GB:PRODUCT ybaK/ebsC protein GB:NOTE TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA synthetase associated region; KEGG: sus:Acid_5432 YbaK/EbsC protein GB:PROTEIN_ID ACV55921.1 GB:DB_XREF GI:257475601 InterPro:IPR004369 InterPro:IPR007214 LENGTH 161 SQ:AASEQ MSKEHDRKTNAMRVLDAAGTPYEARFFDCPEAVSGVEVARILELDPDTVFKTLVTRGKSGEHYVFMIPVACELDLKKAAAVVGEKAVAMIRSRELLGLTGYVHGGCSPLAMLKPFPTAIDETCRLHERIAFSGGRIGCQIEMAPDDLARAVPLAVADLTVV GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 3->159|EBSC_ENTFA|3e-21|35.7|157/164| SEG 76->88|kkaaavvgekava| BL:PDB:NREP 1 BL:PDB:REP 9->158|2dxaA|5e-13|43.2|146/154| RP:PDB:NREP 1 RP:PDB:REP 9->158|1dbxA|5e-25|27.2|147/150| RP:PFM:NREP 1 RP:PFM:REP 30->147|PF04073|1e-09|28.8|118/122|YbaK| HM:PFM:NREP 1 HM:PFM:REP 30->149|PF04073|2.3e-26|34.2|120/123|YbaK| RP:SCP:NREP 1 RP:SCP:REP 9->158|1dbuA|8e-28|29.9|147/152|d.116.1.1| HM:SCP:REP 9->160|1wdvA_|9.5e-37|37.3|150/0|d.116.1.1|1/1|YbaK/ProRS associated domain| OP:NHOMO 300 OP:NHOMOORG 299 OP:PATTERN -------------------------------------------------------------------- 111-11-1111-1------------1----------1111----11-11---11111---11111-1-11-1------1111------1111-111----------------------------------------1-------1----------------------111----------------------111111111111111111----11111--1-11111111111111111111111111111111-1--111-11111--11------------1---------------------------------------11-1-------1-111---1211--11111--11-1-----------111-------------1--1-1-1--1-----------------1-------11--11---1----------------------------------------------------------------1-----------------------------------------------1---------------------------1-1-111-1-----------------11--111-1----------------1-------111------11111-1111111-11111------1------1-111111111111111-11111111-1111111111---11-11----------------11111111--111111111111--------------1111111---11111----11111-11111-11111111111111111----------11111111111-1111----------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 94.4 SQ:SECSTR #######HcHHHHHHHHHTcccEEEEcEEcccccccHHHHHHTccGGGcEEEEEEEETTcTTcEEEEEEETTcccHHHHHHHHTcccEEEcHHHHHHHHcccTTccccccccccccEEEEGGGGGcccEEEEcccTTEEEEEcHHHHHHHHTcEEEccE## DISOP:02AL 161-162| PSIPRED cccccccccHHHHHHHHccccEEEEEEcccccccHHHHHHHccccHHHEEEEEEEEEccccEEEEEEEcccEEcHHHHHHHHcccccEEccHHHHHHHccccccccccccccccccEEEEHHHHccccEEEccccccEEEEEcHHHHHHHHccEEEEEEEc //