[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55926.1
DDBJ      :             CopG domain protein DNA-binding domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->73 2cadB PDBj 4e-04 12.9 %
:HMM:PFM   6->42 PF01402 * RHH_1 2.5e-09 37.8 37/39  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55926.1 GT:GENE ACV55926.1 GT:PRODUCT CopG domain protein DNA-binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2301408..2301638 GB:FROM 2301408 GB:TO 2301638 GB:DIRECTION + GB:PRODUCT CopG domain protein DNA-binding domain protein GB:NOTE PFAM: CopG domain protein DNA-binding domain protein; KEGG: hso:HS_0447 hypothetical protein GB:PROTEIN_ID ACV55926.1 GB:DB_XREF GI:257475606 InterPro:IPR002145 LENGTH 76 SQ:AASEQ MPSSTMTIRLDQNEKNLIADYAQAFGTSVSEFMRKAALERIEDDIDLKTWYAAKAEFDENPVAHSNDEVMREFGLR GT:EXON 1|1-76:0| RP:PDB:NREP 1 RP:PDB:REP 4->73|2cadB|4e-04|12.9|70/134| HM:PFM:NREP 1 HM:PFM:REP 6->42|PF01402|2.5e-09|37.8|37/39|RHH_1| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------11--------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 100.0 SQ:SECSTR cccccccccccHHHHHHHHTTTTTTTccHHHHHHHHHHHHHHccccEEEEEEEEEETTcTTHHHHHHHHHHHHHHH DISOP:02AL 76-77| PSIPRED ccccEEEEEEcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccc //