[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55930.1
DDBJ      :             peptidase M42 family protein
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  283/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.49.3c.56.5
:383 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->349 1xfoB PDBj 7e-54 41.7 %
:RPS:PDB   6->347 2cf4A PDBj 2e-25 27.5 %
:RPS:SCOP  8->81 2fvgA2  c.56.5.4 * 8e-13 32.4 %
:RPS:SCOP  71->179 2greA1  b.49.3.1 * 5e-16 27.2 %
:RPS:SCOP  157->348 1vhoA2  c.56.5.4 * 1e-53 40.0 %
:HMM:SCOP  3->348 1vhoA2 c.56.5.4 * 1.2e-66 41.9 %
:RPS:PFM   46->339 PF05343 * Peptidase_M42 6e-50 43.0 %
:HMM:PFM   46->339 PF05343 * Peptidase_M42 6.2e-84 43.9 287/292  
:BLT:SWISS 6->348 Y555_METJA 1e-53 37.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55930.1 GT:GENE ACV55930.1 GT:PRODUCT peptidase M42 family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2303345..2304496) GB:FROM 2303345 GB:TO 2304496 GB:DIRECTION - GB:PRODUCT peptidase M42 family protein GB:NOTE PFAM: peptidase M42 family protein; peptidase M20; KEGG: pca:Pcar_1216 putative lyase/synthase GB:PROTEIN_ID ACV55930.1 GB:DB_XREF GI:257475610 InterPro:IPR002933 InterPro:IPR008007 LENGTH 383 SQ:AASEQ MKNKQVKFLKQLLETPSATGTEIAVAELVRERLAGTADEIQTDVMGSVHARLSGTGVAPSLMLSAHMDEIGLMVTYISDEGFLSVSSVGGVDAAILPGMRVDVHASNSFEPLRGVVGRKPIHLIEPDERKNVTPIDKLVIDLGMPAKRVKKLVMVGDVITFGVGFERFGKNMAVSRAFDDKAGVWVAVRVLETLAKEGRAPGDFIVAATVQEEIGTRGAITSAYGLDPDVAIAFDVTHATDYPGIDKTKYGKIVCGEGPVIARGPNINPAVFERLVAAAEAEGLPYQIEAEPGVTGTDARSIQISRGGVPTGLVSVPLRYMHTPTEVVSLDDLDATVKLLARFARDLDEDACFVPGMGDAVTEGDGAGAESAAQMQFDETGVE GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 6->348|Y555_METJA|1e-53|37.5|336/350| BL:PDB:NREP 1 BL:PDB:REP 7->349|1xfoB|7e-54|41.7|324/337| RP:PDB:NREP 1 RP:PDB:REP 6->347|2cf4A|2e-25|27.5|324/327| RP:PFM:NREP 1 RP:PFM:REP 46->339|PF05343|6e-50|43.0|286/292|Peptidase_M42| HM:PFM:NREP 1 HM:PFM:REP 46->339|PF05343|6.2e-84|43.9|287/292|Peptidase_M42| RP:SCP:NREP 3 RP:SCP:REP 8->81|2fvgA2|8e-13|32.4|73/237|c.56.5.4| RP:SCP:REP 71->179|2greA1|5e-16|27.2|92/94|b.49.3.1| RP:SCP:REP 157->348|1vhoA2|1e-53|40.0|180/244|c.56.5.4| HM:SCP:REP 3->348|1vhoA2|1.2e-66|41.9|246/0|c.56.5.4|1/1|Zn-dependent exopeptidases| OP:NHOMO 584 OP:NHOMOORG 335 OP:PATTERN 111-11----------222222211111112111111111111111111111113332333---3--- --1------------11-------------------------------------------------------------111-2--------1----21-1-111112111--------------------------22211---14-------------------------------------411--4414233333333323333334233333222222533222222413222222222222222223231-1-21-111----11---11-11122221112111111111121111111111111112221112222-3331----------31323-----3114-1--33-----1--363----1-1--------------------------------1-1--1-1----1-----------11------1-------------------------------------------------------------------------------------------------------------------------------------------------111111111-------1-------------------------------------------------------------21-------1------3221311122-2232221222222333332--------1111111111111111-2-12222-----------------------1111----------------------------------------------111-----------------------------------------1----------------21-1---2--12--111----121114333334333113 -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 381 STR:RPRED 99.5 SQ:SECSTR GGGccHHHHHHHHHccccTTccHHHHHHHHTTTTccGGccEEcccccEEEcccccEccccccEEEEccccEEEEEEEcTTccEEEEEEccccGGGTTTcEEEEEccccEEEEHHEEccccccccccccccccccTTccccccccccHHHHTTccTTcEEEEccccEEccccEEEcTTHHHHHHHHHHHHHHHccGGGccccccEEEEEcccTTTTcHHHHHHTTTcccccEEEccEEEccccccTTccTTcccEEEEEcccEEcccccHHHHHHHHHHHHTTTcccEEEEcccccccGGGGTTTccccccEEEEEEEEEcTTTTTcEEEHHHHHHHHTTccTTTTTcHccHHccccccHHHH##HHHHHHHHHHHHHHHHTTc DISOP:02AL 383-384| PSIPRED ccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccEEEEEcccEEEEEEcccccccEEEEEEEccccEEEEEEEccccEEEEEEEccccHHHHcccEEEEEEccccEEEEEEEccccccEEcHHHccccccHHHEEEEcccccHHHHHccccccEEEEccccEEEcccEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHcccccccEEEEEEEEcccccccccHHHcccEEcccccEEcccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHcccccEEEEEccccccccccEEEEEHHHHHHHHHHHHHHHHHcccHHcccccccccccccccccccccEEEEccccccc //