[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55935.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  173/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.2
:151 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   25->137 1s4cB PDBj 1e-12 32.1 %
:RPS:SCOP  1->149 1jopA  b.82.2.7 * 3e-28 29.9 %
:HMM:SCOP  1->151 1jopA_ b.82.2.7 * 1.5e-44 40.0 %
:RPS:PFM   1->149 PF04074 * DUF386 1e-31 44.3 %
:HMM:PFM   1->150 PF04074 * DUF386 3.7e-41 38.0 150/153  
:BLT:SWISS 37->149 YHCH_ECOLI 1e-18 34.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55935.1 GT:GENE ACV55935.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2308431..2308886) GB:FROM 2308431 GB:TO 2308886 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE PFAM: conserved hypothetical protein; KEGG: vfi:VF_0669 hypothetical protein GB:PROTEIN_ID ACV55935.1 GB:DB_XREF GI:257475615 InterPro:IPR004375 LENGTH 151 SQ:AASEQ MLVTTLDHAAGNDYLAARFQKAYAFLNRDDLGSLPLGRVDIDGDAVFANVQEYDTVPAEEKQLEAHRRYYDVQFVVSGEEVMQYAPLEGLAKVQPFDEDADFGLYCTPERPSSIVLRAGDVAVLAPEDAHKPGCALDAPCCVRKIVVKVLV GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 37->149|YHCH_ECOLI|1e-18|34.5|113/154| TM:NTM 1 TM:REGION 131->151| BL:PDB:NREP 1 BL:PDB:REP 25->137|1s4cB|1e-12|32.1|112/155| RP:PFM:NREP 1 RP:PFM:REP 1->149|PF04074|1e-31|44.3|149/153|DUF386| HM:PFM:NREP 1 HM:PFM:REP 1->150|PF04074|3.7e-41|38.0|150/153|DUF386| RP:SCP:NREP 1 RP:SCP:REP 1->149|1jopA|3e-28|29.9|134/140|b.82.2.7| HM:SCP:REP 1->151|1jopA_|1.5e-44|40.0|150/0|b.82.2.7|1/1|Clavaminate synthase-like| OP:NHOMO 317 OP:NHOMOORG 173 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1-1-------1111-1-----------1----------------------------1-------------------------------------------------------------------------------------------------1--------------------------------------1----------1---1--31132312121-1------1----1--------1---1------------1---111------1-------------------1----------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------1-1--------------------1------111------------------1-------------------11-----111--------1111111111111111111--1----------333122-3224343333-233344334324333333313112--1313333333333333223222221--332333333333------------------111312111111112---------------------------------------111111111-----------------------------------------------------111---------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 74.2 SQ:SECSTR ########################HHTTccGGGcccEEEEcc#cccEEEEEccccccGGGccEEEcccEEEEEEEEEccEEEEEcccccGGGcccccTTTTcEEEcccTTEEEEEEcTTEEEEEcTTccEEEEEccT############## PSIPRED cEEEcHHHHHHcccccHHHHHHHHHHHHccHHHcccccEEcccccEEEEEEccccccccccccccccEEEEEEEEEEccEEEEEEEcccccEEccccccccEEEEcccccEEEEEEccccEEEEccccHHcccccccccccEEEEEEEEEc //