[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55956.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   96->163 PF11361 * DUF3159 0.00095 22.4 67/188  
:BLT:SWISS 72->156 Y562A_THEMA 1e-06 31.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55956.1 GT:GENE ACV55956.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2335172..2335987) GB:FROM 2335172 GB:TO 2335987 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: sat:SYN_00670 hypothetical protein GB:PROTEIN_ID ACV55956.1 GB:DB_XREF GI:257475636 LENGTH 271 SQ:AASEQ MGRVREVFAAMGREMRKNKGSFAVYVVLRLIVLACAVGSLAFDNYEAFFLCLLTLVLFLVPTFIEVNFSISIPETLEVVIALFIFAAEILGELLHFYTIFPFWDALLHTFNGFLAAAIGLALVSILNRSDRIAFSLSPFFCVVVAFCFSMTIGVLWEFFEFGMDEMFGLDMQKDTVMTGISSTLLDPSGSQHPQRIDRIESVEVNGQELGVGGYLDIGLRDTMGDLFVNFVGALVFSVIGYRYLKSKGEGRFVRRFVPTPAPPDDVETLTI GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 72->156|Y562A_THEMA|1e-06|31.2|80/100| TM:NTM 5 TM:REGION 22->43| TM:REGION 47->69| TM:REGION 79->101| TM:REGION 107->129| TM:REGION 138->160| SEG 48->63|fflclltlvlflvptf| SEG 157->168|effefgmdemfg| HM:PFM:NREP 1 HM:PFM:REP 96->163|PF11361|0.00095|22.4|67/188|DUF3159| OP:NHOMO 21 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------1------------------ ---------------------------------------------------------------------------111--1------------------------------------------------------------------------------------------------------------------------------------------------222222---------------------------------------1-------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 271-272| PSIPRED ccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHcccc //