[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55965.1
DDBJ      :             CopG family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:85 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   40->80 1ea4A PDBj 1e-05 24.4 %
:RPS:SCOP  37->85 1bazA  a.43.1.1 * 2e-05 22.4 %
:HMM:SCOP  38->80 2cpgA_ a.43.1.3 * 0.00017 34.9 %
:HMM:PFM   37->82 PF09517 * RE_Eco29kI 0.00099 30.4 46/170  
:REPEAT 2|46->60|69->83

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55965.1 GT:GENE ACV55965.1 GT:PRODUCT CopG family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2347264..2347521) GB:FROM 2347264 GB:TO 2347521 GB:DIRECTION - GB:PRODUCT CopG family protein GB:NOTE KEGG: neu:NE2103 CopG family protein GB:PROTEIN_ID ACV55965.1 GB:DB_XREF GI:257475645 LENGTH 85 SQ:AASEQ MSNEKITSENLEELFDEGCDVTGFFDFDSAVVVEGRTETKRVNVDMPIWMVEALDKEAKRVGIGRQAVIKMWLAERLDEEARRSA GT:EXON 1|1-85:0| NREPEAT 1 REPEAT 2|46->60|69->83| RP:PDB:NREP 1 RP:PDB:REP 40->80|1ea4A|1e-05|24.4|41/42| HM:PFM:NREP 1 HM:PFM:REP 37->82|PF09517|0.00099|30.4|46/170|RE_Eco29kI| RP:SCP:NREP 1 RP:SCP:REP 37->85|1bazA|2e-05|22.4|49/49|a.43.1.1| HM:SCP:REP 38->80|2cpgA_|0.00017|34.9|43/0|a.43.1.3|1/1|Ribbon-helix-helix| OP:NHOMO 25 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------11---1----------------------------------------------2-1---2----------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1-----------1-1----1-------1------------------------------1---------------------------------------2--1----------------------------------------------------------------------------------------------------------1------------------------------------------------------1---1-11------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 60.0 SQ:SECSTR ##################################cccccccccccccHHHHHHHHHHHHHHTccHHHHHHHHHHHHTTccccccc PSIPRED cccccccHHHHHHHHHccccEEEEEEccccEEEccccEEEEEccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //