[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55970.1
DDBJ      :             iojap-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  754/915 : Eukaryota  41/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->120 2o5aA PDBj 6e-13 36.9 %
:RPS:SCOP  11->117 2id1A1  d.218.1.12 * 3e-31 32.1 %
:RPS:PFM   20->112 PF02410 * DUF143 8e-19 45.7 %
:HMM:PFM   18->112 PF02410 * DUF143 5.7e-33 45.3 95/100  
:BLT:SWISS 14->120 IOJAP_MAIZE 1e-16 41.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55970.1 GT:GENE ACV55970.1 GT:PRODUCT iojap-like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2352947..2353375) GB:FROM 2352947 GB:TO 2353375 GB:DIRECTION - GB:PRODUCT iojap-like protein GB:NOTE TIGRFAM: iojap-like protein; PFAM: Iojap-related protein; KEGG: gur:Gura_4129 iojap-like protein GB:PROTEIN_ID ACV55970.1 GB:DB_XREF GI:257475650 InterPro:IPR004394 LENGTH 142 SQ:AASEQ MSTTTTEKTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKAQMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDLAAEAGLTDIEYSDRIAKMLGKE GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 14->120|IOJAP_MAIZE|1e-16|41.0|105/228| BL:PDB:NREP 1 BL:PDB:REP 9->120|2o5aA|6e-13|36.9|103/107| RP:PFM:NREP 1 RP:PFM:REP 20->112|PF02410|8e-19|45.7|92/99|DUF143| HM:PFM:NREP 1 HM:PFM:REP 18->112|PF02410|5.7e-33|45.3|95/100|DUF143| RP:SCP:NREP 1 RP:SCP:REP 11->117|2id1A1|3e-31|32.1|106/120|d.218.1.12| OP:NHOMO 811 OP:NHOMOORG 795 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111-1111111111111--1111111111111111111111111111111111--1--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111------------11------1-11-11111111111-11111111-11211111-11-1111111111111111111111111-------1-111-111-11111111111-1111111111111111111-1111-1111111111----1111111111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111--1111111111111111111111-------------------------1111111111-111111111111111111111--1111-------11----11--1111-11-1121111111111111111111--11111111111111111111-1---1-1-11111111111111-1---1-11111111-1111111111111111111111111111111111111111111111111-11111111111111111111--------11111-11--1111------------------------------------11-1-11111111 --------------1-----------------------------------------------------------------------------------------11--1-------1---11--11-1-141-1111---1-11--1---1-1--11-1----------------2--17211211112-11-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 76.8 SQ:SECSTR ########ccHHHHHHHHHHHHHTTcEEEEEEEcGGTcTTccEEEEEEEccHHHHHHHHHHHHHHHHHTTcccEEccEcTTTTcEEEEEcccEEEEEEETTcGGGTcTTTcc###ccccc###################### PSIPRED cccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHcccccEEEcccccccEEEEEcccEEEEcccHHHHHHHHHHHHHccccEEEcccHHccccccccHHHHHHHccc //