[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55974.1
DDBJ      :             glutamate 5-kinase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  722/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
b.122.1c.73.1d.276.1
:382 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->379 2j5tD PDBj 1e-62 38.2 %
:RPS:PDB   14->265 2akoA PDBj 2e-42 33.5 %
:RPS:SCOP  14->264 2akoA1  c.73.1.3 * 6e-41 33.2 %
:RPS:SCOP  236->380 1rylA  d.276.1.1 * 1e-13 9.4 %
:HMM:SCOP  14->267 2akoA1 c.73.1.3 * 2.3e-66 40.0 %
:HMM:SCOP  287->381 2cx1A1 b.122.1.1 * 2.9e-17 43.8 %
:RPS:PFM   127->197 PF00696 * AA_kinase 1e-08 46.5 %
:HMM:PFM   14->243 PF00696 * AA_kinase 6.4e-43 28.6 220/243  
:HMM:PFM   288->355 PF01472 * PUA 6.6e-18 41.8 67/74  
:BLT:SWISS 14->380 PROB_THISH 5e-71 40.5 %
:PROS 216->233|PS00902|GLUTAMATE_5_KINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55974.1 GT:GENE ACV55974.1 GT:PRODUCT glutamate 5-kinase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2355956..2357104) GB:FROM 2355956 GB:TO 2357104 GB:DIRECTION - GB:PRODUCT glutamate 5-kinase GB:NOTE KEGG: gsu:GSU3212 gamma-glutamyl kinase; TIGRFAM: glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate kinase; PUA domain containing protein; SMART: PUA domain containing protein GB:PROTEIN_ID ACV55974.1 GB:DB_XREF GI:257475654 InterPro:IPR001048 InterPro:IPR001057 InterPro:IPR002478 InterPro:IPR005715 LENGTH 382 SQ:AASEQ MKPAGCAHAADHGKRLVIKIGSSTLTTSESKIDYAYLAEVTDQVARVRAAGWRPIVVTSAAIACGLERLSIEKRPHDMPSLQAAASVGQSALSTAYAEAFARHGIVTSTVLLTRRDTADRRAYLHARDTFDRLLELGVVPIVNENDTISVEQIRFGDNDTLAALVACLVEADLMVILSDIEGLYDANPHHHPDANLIGRVEAIGPEIMAVAGEAGTTVGSGGMITKIKAARVLMVAGIPLVVCDGHRAEAIVDAAAGEDVGTLFVAAKKPHEITPKKLWIALGDAARGALAVDDGAKAALIERGSSLLSVGVRSVEGRFEANDIVDIKDATGHLFARGKVAFASDEAALAIGRTRAELQANRLLASLADKPLVHRDELVVFE GT:EXON 1|1-382:0| BL:SWS:NREP 1 BL:SWS:REP 14->380|PROB_THISH|5e-71|40.5|363/375| PROS 216->233|PS00902|GLUTAMATE_5_KINASE|PDOC00701| SEG 303->315|rgssllsvgvrsv| BL:PDB:NREP 1 BL:PDB:REP 16->379|2j5tD|1e-62|38.2|359/365| RP:PDB:NREP 1 RP:PDB:REP 14->265|2akoA|2e-42|33.5|236/237| RP:PFM:NREP 1 RP:PFM:REP 127->197|PF00696|1e-08|46.5|71/244|AA_kinase| HM:PFM:NREP 2 HM:PFM:REP 14->243|PF00696|6.4e-43|28.6|220/243|AA_kinase| HM:PFM:REP 288->355|PF01472|6.6e-18|41.8|67/74|PUA| GO:PFM:NREP 1 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| RP:SCP:NREP 2 RP:SCP:REP 14->264|2akoA1|6e-41|33.2|238/241|c.73.1.3| RP:SCP:REP 236->380|1rylA|1e-13|9.4|128/157|d.276.1.1| HM:SCP:REP 14->267|2akoA1|2.3e-66|40.0|250/0|c.73.1.3|1/1|Carbamate kinase-like| HM:SCP:REP 287->381|2cx1A1|2.9e-17|43.8|89/0|b.122.1.1|1/1|PUA domain-like| OP:NHOMO 1014 OP:NHOMOORG 906 OP:PATTERN ---------------------------111-1-----------------1111--------------- -1-1111111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111-------1-111-111---------------11111111111111111111-11111111111111111111111111111111111111111111111211111111-11111111222211111111--11111111--------------------1---11-1---111111-1-11111111111111111111211111111111111111-1111111111112111-------1-11-221111111--111111111111-111111--1111111111111111111111111111111111111-11111111121-1111111111121111211111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111-111111111111111111-1111111---1-------2111133111211112221222222122222111211---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111111111111111-11111111111111111111111111111111111111--------111111111111111111111111111111111111111---------1---------------------------11--1-111111 --11--1-31--111111-1111111111111111111111111111-11111111111111111111-1221112212211111111-11111111-11111311--2-22322211111-11111112B2--2311-1211111111111111111211--111-1112122-1212E2221212331312133321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 371 STR:RPRED 97.1 SQ:SECSTR #########TccccEEEEEEcHHHHcccccTccHHHHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHGGGTccEEEEEEcTGGGGcHHHHHHHHHHHHHHHHTTcEEEEEEcTTTccHHHHcTTTHHHHHHHHHHTTccEEEEEEcccccccccTTTcTTcccccEEcccHHHHHHTcccGGGcccccHHHHHHHHHHHHHHTTcEEEEEccccHHHHHHHHcccccccEEEccEEEEEEEEEEEEEEEEccccTTccHHHHHHHHHHTHHHHGTTccEEEEEccTTccEEEEEEETTcHHHHHHHHHHHTcccccccEEEEEEEEEEEEEEEEEEccTTTTcTTHH## DISOP:02AL 382-383| PSIPRED cccHHHHHHcccccEEEEEEcccEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEcccccEEccccccccccHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEcccccHHHHHHHccccccccccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHccccccEEEEEcccccccHHHHHHHHcccccccEEEEcHHHHHHHHHccccccHHHHHHHccccccccEEEEEcccccEEEHHHHcccHHHHHHHccccHHHHHHHHHHcccccccEEEcccEEEcc //