[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55991.1
DDBJ      :             aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.68.1d.144.1
:589 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   70->290 1jylA PDBj 3e-34 32.1 %
:BLT:PDB   321->504 2qg7E PDBj 3e-07 28.3 %
:RPS:PDB   1->63 3bddB PDBj 6e-07 17.5 %
:RPS:PDB   66->143 2e3dC PDBj 1e-13 26.9 %
:RPS:PDB   318->586 3dxqB PDBj 5e-18 19.9 %
:RPS:SCOP  6->63 2obpA1  a.4.5.71 * 1e-05 17.2 %
:RPS:SCOP  70->290 1jykA  c.68.1.13 * 2e-45 32.1 %
:RPS:SCOP  302->552 1zylA1  d.144.1.6 * 9e-10 14.0 %
:HMM:SCOP  1->57 1biaA1 a.4.5.1 * 5.4e-05 26.3 %
:HMM:SCOP  65->293 1jykA_ c.68.1.13 * 9.9e-31 23.1 %
:HMM:SCOP  272->553 1nw1A_ d.144.1.8 * 1.9e-31 18.3 %
:RPS:PFM   7->50 PF01047 * MarR 3e-04 38.6 %
:RPS:PFM   70->140 PF00483 * NTP_transferase 6e-11 45.1 %
:RPS:PFM   446->519 PF01633 * Choline_kinase 2e-06 35.1 %
:HMM:PFM   318->533 PF01636 * APH 5.5e-22 20.9 211/238  
:HMM:PFM   70->161 PF00483 * NTP_transferase 3.7e-08 28.3 92/248  
:HMM:PFM   13->48 PF09339 * HTH_IclR 2.5e-07 37.1 35/52  
:BLT:SWISS 69->295 LICC_HAEIN 5e-19 25.6 %
:BLT:SWISS 324->566 LICA2_HAEIN 5e-21 26.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55991.1 GT:GENE ACV55991.1 GT:PRODUCT aminoglycoside phosphotransferase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2373994..2375763) GB:FROM 2373994 GB:TO 2375763 GB:DIRECTION - GB:PRODUCT aminoglycoside phosphotransferase GB:NOTE PFAM: aminoglycoside phosphotransferase; Choline/ethanolamine kinase; protein of unknown function DUF227; KEGG: hip:CGSHiEE_05255 LicA GB:PROTEIN_ID ACV55991.1 GB:DB_XREF GI:257475671 InterPro:IPR002573 InterPro:IPR002575 InterPro:IPR004119 LENGTH 589 SQ:AASEQ MSLEKNEFKTLVASMDEGVYTQRALADASGLSLGTVNRLCQTLRDRGLMDGFYVTAEGYRALQPYKVENAIIMAAGLSSRFAPLSYEKPKGVLNVRGEVLIERQIRQLKAAGIDDITVVVGYMKEAFFYLEDLYGVSIRVNEEYVARNNNSTLMLVREQLGNTYICSSDDYFTENVFEPYVYEAYYAGMYFEGPTDEYCMKTARDGRIIGVTVGGADAFGMLGHAYFDRAFSSAFSAILENEYDWPETAPKLWEDLFRDHVKDLRMVLRCYGPGVIYEFDSLSDLKQFDQDFLMNVDSEILDNICDVLGCTRDRVEGIVPIKEGLTNLSFRFSVDGASYVYRHPGPGADEIINRRSEAHSQAVAKKLGIDDTFVFQDTRKGWKVSRFVKDCKPFDYHDGSHVEQAMDLIRRLHQSGETSQWTYDLFEKAQSMMALLGARSYPSFPDYEPLRDRAARLDALVKRDGVAPCLCHNDFYNPNFLVSEEAMYLIDWEYSAMSDYASDLGVFICCSDYDEDEADRVLETYFQRALTAEEYRHCIAFVALAAYHWFIWALYKEAAGDSVGEWLYLWYRYAKTYSAKALALYEDER GT:EXON 1|1-589:0| BL:SWS:NREP 2 BL:SWS:REP 69->295|LICC_HAEIN|5e-19|25.6|227/233| BL:SWS:REP 324->566|LICA2_HAEIN|5e-21|26.6|241/339| BL:PDB:NREP 2 BL:PDB:REP 70->290|1jylA|3e-34|32.1|221/228| BL:PDB:REP 321->504|2qg7E|3e-07|28.3|184/369| RP:PDB:NREP 3 RP:PDB:REP 1->63|3bddB|6e-07|17.5|63/131| RP:PDB:REP 66->143|2e3dC|1e-13|26.9|78/288| RP:PDB:REP 318->586|3dxqB|5e-18|19.9|251/280| RP:PFM:NREP 3 RP:PFM:REP 7->50|PF01047|3e-04|38.6|44/59|MarR| RP:PFM:REP 70->140|PF00483|6e-11|45.1|71/238|NTP_transferase| RP:PFM:REP 446->519|PF01633|2e-06|35.1|74/202|Choline_kinase| HM:PFM:NREP 3 HM:PFM:REP 318->533|PF01636|5.5e-22|20.9|211/238|APH| HM:PFM:REP 70->161|PF00483|3.7e-08|28.3|92/248|NTP_transferase| HM:PFM:REP 13->48|PF09339|2.5e-07|37.1|35/52|HTH_IclR| GO:PFM:NREP 5 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| GO:PFM GO:0009058|"GO:biosynthetic process"|PF00483|IPR005835| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF00483|IPR005835| RP:SCP:NREP 3 RP:SCP:REP 6->63|2obpA1|1e-05|17.2|58/81|a.4.5.71| RP:SCP:REP 70->290|1jykA|2e-45|32.1|221/229|c.68.1.13| RP:SCP:REP 302->552|1zylA1|9e-10|14.0|250/325|d.144.1.6| HM:SCP:REP 1->57|1biaA1|5.4e-05|26.3|57/0|a.4.5.1|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 65->293|1jykA_|9.9e-31|23.1|229/0|c.68.1.13|1/1|Nucleotide-diphospho-sugar transferases| HM:SCP:REP 272->553|1nw1A_|1.9e-31|18.3|278/395|d.144.1.8|1/1|Protein kinase-like (PK-like)| OP:NHOMO 110 OP:NHOMOORG 69 OP:PATTERN ------------------------1--------1----------1----------------------- ------------------------------------------------------------------------------1232------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------22222222222------------------------11-3-------2-2-1--2222-1----42-----1----1------3-----------------1--------------------11-11-1--1--1--1---1------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------1-----1----------------------------------------------------------------1--------------------------------------------------------------------------------------------1------1111---------2--2224-22-----------------------------1----------1------------------------------2--------------11-----------2--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 589 STR:RPRED 100.0 SQ:SECSTR HcccHHHHHHHHHHHHcccEEHHHHHHHHTccHHHHHHHHHHHHHTTcEEHHHHHccTTTTTccccccEEEEEcccccGGGTTGGGcccGGGcEETTEEHHHHHHHHHHHTTccEEEEEEcGGGHHHHHHcccHHHHHTTccHcccccHHHHHHTTHHHHHHHcEEcccEEccTHHHHHHHccEEEEEEEEETGGGGcEEEEcTTccEEEEEEccTTccEEEEEcccccccHHHHTcccGGGccccTTcEccEEEEEEEEEHHHHHHHHHccccHHHHHHTcTTHHHHHHcHHHHHHHHHHHHccTHHHHccGGGcccEEEccccccEEEEETccccTEEEEEccccHHHEccHHHHHHHHHHHHHTTccccEEEEcTcTTccEEEccTTcHHHHHHcTTHHHHHHHHHHHHHTcccccccccccHHHHHHHHHHHTTccccccTTHHHHHHHHHHHHHHHHTcccccEEEcccccGGGEEEcccccEEcccTTccEEcHHHHHHHHHHHTTccHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHcHHHHHHH PSIPRED ccccccHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHEEccccEEEEEEEEHHHHHHHccccccEEEEEcccccccccHHHccccccEEEEccEEHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHccccEEEEEccEEccccHHHHHHHHHcccEEEEccccccEEEEcccccEEEEEEccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccEEEEEccHHHHHHHHHHHccccccHHHHHHHHHcccccccEEEEEEEccccccEEEEEEEccccEEEEEcccHHHHHccHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccccEEEEcccEEEEEEccccccHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccc //