[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55992.1
DDBJ      :             CTP:phosphocholine cytidylyltransferase-like protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  78/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.68.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->54 3i59B PDBj 2e-04 50.0 %
:BLT:PDB   73->295 1jylA PDBj 8e-23 26.7 %
:RPS:PDB   5->54 1bibA PDBj 6e-07 14.6 %
:RPS:PDB   70->157 2e3dC PDBj 1e-15 25.0 %
:RPS:SCOP  11->54 1oyiA  a.4.5.19 * 5e-07 20.5 %
:RPS:SCOP  73->297 1jykA  c.68.1.13 * 8e-29 27.5 %
:HMM:SCOP  5->54 1ku9A_ a.4.5.36 * 3.9e-06 40.8 %
:HMM:SCOP  69->297 1jykA_ c.68.1.13 * 5.1e-28 25.0 %
:RPS:PFM   74->135 PF00483 * NTP_transferase 2e-09 45.2 %
:HMM:PFM   74->163 PF00483 * NTP_transferase 1.8e-11 28.9 90/248  
:HMM:PFM   10->54 PF09339 * HTH_IclR 7.6e-08 36.4 44/52  
:BLT:SWISS 74->285 LICC_HAEIN 9e-22 29.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55992.1 GT:GENE ACV55992.1 GT:PRODUCT CTP:phosphocholine cytidylyltransferase-like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2375941..2376843) GB:FROM 2375941 GB:TO 2376843 GB:DIRECTION - GB:PRODUCT CTP:phosphocholine cytidylyltransferase-like protein GB:NOTE involved in choline phosphorylation for cell surface LPS epitopes; KEGG: hiq:CGSHiGG_00270 lic-1 operon protein GB:PROTEIN_ID ACV55992.1 GB:DB_XREF GI:257475672 LENGTH 300 SQ:AASEQ MSRSLDVKDFKILTALEARVDESLTQREIAAAADLSVGTVNRAMADLHERGFVREGMLSAAGLEALEPYRVKRAVLIAAGFGSRLVPITLNTPKPLIRVQGQRIIDSLLDAVFAAGIEEVYVVRGYLAEQFDQLLYKYPHVKFIENPFYNEANNISSAVAAKDLLQNAYVFESDLLLYNPKLITKYQYSSNYLGVPVPVTDDWCFQTRRGVITGLTVGGTDCHHMFGISYWTEEDGRKLADDVPATFAMPGGKERYWDEVALRYFARNYEVSVRECTFDDVIEIDTYRELQQLDKSYVVG GT:EXON 1|1-300:0| BL:SWS:NREP 1 BL:SWS:REP 74->285|LICC_HAEIN|9e-22|29.2|209/233| BL:PDB:NREP 2 BL:PDB:REP 19->54|3i59B|2e-04|50.0|36/202| BL:PDB:REP 73->295|1jylA|8e-23|26.7|221/228| RP:PDB:NREP 2 RP:PDB:REP 5->54|1bibA|6e-07|14.6|48/294| RP:PDB:REP 70->157|2e3dC|1e-15|25.0|88/288| RP:PFM:NREP 1 RP:PFM:REP 74->135|PF00483|2e-09|45.2|62/238|NTP_transferase| HM:PFM:NREP 2 HM:PFM:REP 74->163|PF00483|1.8e-11|28.9|90/248|NTP_transferase| HM:PFM:REP 10->54|PF09339|7.6e-08|36.4|44/52|HTH_IclR| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00483|IPR005835| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF00483|IPR005835| RP:SCP:NREP 2 RP:SCP:REP 11->54|1oyiA|5e-07|20.5|44/62|a.4.5.19| RP:SCP:REP 73->297|1jykA|8e-29|27.5|222/229|c.68.1.13| HM:SCP:REP 5->54|1ku9A_|3.9e-06|40.8|49/151|a.4.5.36|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 69->297|1jykA_|5.1e-28|25.0|224/0|c.68.1.13|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 102 OP:NHOMOORG 83 OP:PATTERN -----------------------1--------1------------1---------------------1 ------------------------------------------------------------------------------1232---------1-2-------------------------------------11--1------------------------------------------------------------------------1----------------------1---------------------------------------------------------11111112111---------------------------2-------1-1-1--1111-1----52----------1------3--------------------------------------------------1---1--1-11---11-------------------------1------------------------------1--11------------------------------------------1-----------------------111-------------1------------1-----2-------1-1111-1--------1------------------------------1---------1----------------------------------------------------------------------------------------------------------------1--1112-11----------------------1-1---------------1--1---------------------------2--------------21-----------1--------------------------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 98.0 SQ:SECSTR cccHccHHHHHHHHHHTTTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEcEEcHHHHHHHTcccccEEEEEcccccGGGTTGGGcccGGGcEETTEEHHHHHHHHHHHTTccEEEEEEcGGGHHHHHHcccHHHHHTTccHHHHHHHTcccHHTTHHHHHHHcEEEcccEEccTHHHHHHHHTTccEEEEEEEEETEEEGGGGcEEEEEEEEEEEEEEcccEEEEcHHHHHHHHHHHHHHHHHTccTTccTTHH#HHTTGGGcccEEcccccccEEEcccHHHHHHHHH##### DISOP:02AL 300-301| PSIPRED cccccccccccccHHHHHHHHHccccccEEccccccHHHHHHHHHHHHHcccHHHHHHHHHccccccccccEEEEEEcccccccccHHHccccccEEEEccEEHHHHHHHHHHHccccEEEEEccccHHHHHHHHHcccccEEEEEEEEEcccccccHHHHHHHHcccEEEEccEEEEEHHHHHHHHHHHHHHcccEEEccccEEEccccEEEEEEEccccccEEEEEEEEcHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHcccEEEEccccEEEEEccHHHHHHHHHHHccc //