[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56047.1
DDBJ      :             alanine racemase domain protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  748/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
c.1.6
:234 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   22->224 1w8gA PDBj 3e-20 33.3 %
:RPS:PDB   38->224 3cpgA PDBj 7e-24 27.3 %
:RPS:SCOP  38->224 1b54A  c.1.6.2 * 3e-20 27.1 %
:HMM:SCOP  1->225 1ct5A_ c.1.6.2 * 3e-59 41.8 %
:RPS:PFM   38->224 PF01168 * Ala_racemase_N 1e-12 35.8 %
:HMM:PFM   12->224 PF01168 * Ala_racemase_N 4.6e-37 33.2 193/214  
:BLT:SWISS 42->226 Y274_AQUAE 9e-28 39.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56047.1 GT:GENE ACV56047.1 GT:PRODUCT alanine racemase domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2451407..2452111) GB:FROM 2451407 GB:TO 2452111 GB:DIRECTION - GB:PRODUCT alanine racemase domain protein GB:NOTE PFAM: alanine racemase domain protein; KEGG: dol:Dole_1179 alanine racemase domain- containing protein GB:PROTEIN_ID ACV56047.1 GB:DB_XREF GI:257475727 InterPro:IPR001608 InterPro:IPR011078 LENGTH 234 SQ:AASEQ MGFKERYERTVAEAAACCEACGRDPKSVVVVAVSKTVGADEVAEAIEAGAHDFGENRPDSLEGKRARFPQQTWHFIGNIQSRRIPDIVRDAALVHSLYQQRHVPKFDAAAAASGKVQDVLLEVNVSGEASKSGLAPSEVAGMLEYCAGFPHVRVRGLMTMAPQGDAQRARACFADLARLRDEVRLGLDGEQAAVFDELSMGMSEDWHEAIAEGATIVRIGRALFDDAFESPAHA GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 42->226|Y274_AQUAE|9e-28|39.2|181/228| SEG 12->21|aeaaacceac| SEG 26->37|ksvvvvavsktv| BL:PDB:NREP 1 BL:PDB:REP 22->224|1w8gA|3e-20|33.3|198/226| RP:PDB:NREP 1 RP:PDB:REP 38->224|3cpgA|7e-24|27.3|183/247| RP:PFM:NREP 1 RP:PFM:REP 38->224|PF01168|1e-12|35.8|176/211|Ala_racemase_N| HM:PFM:NREP 1 HM:PFM:REP 12->224|PF01168|4.6e-37|33.2|193/214|Ala_racemase_N| RP:SCP:NREP 1 RP:SCP:REP 38->224|1b54A|3e-20|27.1|177/230|c.1.6.2| HM:SCP:REP 1->225|1ct5A_|3e-59|41.8|220/0|c.1.6.2|1/1|PLP-binding barrel| OP:NHOMO 959 OP:NHOMOORG 903 OP:PATTERN -------------------------------------------------1111--------------- 11111111111111111--------1----------1-1-111-11111111111-----11-111111111111111111111111111111111---11211121211--------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------11--------1111111111111111111111111111111111111111111111111111111111111121111111111-11111111111111111111-111111111-----111111112121111111111112-111111111111111111-11111111111-11111111111111111111-112-----------------------------111111222121111111111111111111111111111-1111111112111111212111111111111111111111111111111111111111111111121111--11----11111-11---11-1111111111111111111111111111111111--111111-----11211211111111111-1111111111111111111111221111111111111111111111111111-111111111111--1111111111111111111111111111111111-1111111111111111111111111111111111111111111111111221111111111111111--11----------1---------------------------1111111111111 --11111-2111-111111111111--------1-11111-11111--1111-1111-111111-11---11111111--11111111-12-111-1-11---111-1--11-1112--1-11-21111241-111111121111-1-1111-1-11112321111-111-11311-11F1111121-11311111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 90.6 SQ:SECSTR #####################ccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHTTEEEcccccEEEcEEEcccccGGGHHHHTTTccEEEEEccHHHHHHHHHHHHHHTccEEEEEEccccccTTcccccGGGHHHHHHHHHTcTTEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccTTcccHcTTccEEEcTTTHHHHHTTccEEEEcTTTcTccccTTcc# PSIPRED ccHHHHHHHHHHHHHHHHHHHcccHHHcEEEEEEccccHHHHHHHHHccccEEEccHHHHHHHHHHHccccEEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccHHHHHHHHccccEEEEcHHHHcccccccccc //