[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56052.1
DDBJ      :             Aldehyde ferredoxin oxidoreductase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  118/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.110.1d.152.1
:680 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->678 1b25A PDBj 1e-38 32.8 %
:RPS:PDB   5->253 1aorA PDBj 1e-38 34.7 %
:RPS:SCOP  5->235 1aorA2  d.152.1.1 * 4e-51 37.2 %
:RPS:SCOP  461->678 1b25A1  a.110.1.1 * 7e-08 20.2 %
:HMM:SCOP  4->235 1aorA2 d.152.1.1 * 9.9e-48 39.4 %
:HMM:SCOP  236->669 1aorA1 a.110.1.1 * 2.1e-27 26.1 %
:RPS:PFM   7->231 PF02730 * AFOR_N 7e-32 41.5 %
:RPS:PFM   284->665 PF01314 * AFOR_C 9e-16 34.3 %
:HMM:PFM   7->232 PF02730 * AFOR_N 1.1e-60 42.0 200/202  
:HMM:PFM   284->665 PF01314 * AFOR_C 1.5e-27 26.9 309/382  
:BLT:SWISS 6->680 YDHV_ECOLI 2e-43 32.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56052.1 GT:GENE ACV56052.1 GT:PRODUCT Aldehyde ferredoxin oxidoreductase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2456291..2458333 GB:FROM 2456291 GB:TO 2458333 GB:DIRECTION + GB:PRODUCT Aldehyde ferredoxin oxidoreductase GB:NOTE KEGG: spl:Spea_0261 aldehyde ferredoxin oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase; SMART: Aldehyde ferredoxin oxidoreductase GB:PROTEIN_ID ACV56052.1 GB:DB_XREF GI:257475732 InterPro:IPR013983 LENGTH 680 SQ:AASEQ MTEHYGYAGKILIVNLTDRTSQTIDTEPYIEWVGGHGMASKLFWDYCEDKTVEAVDPGNVLVFAATPFSGAVVPAASARCEFTGISPFSLPEWYNRSSMGGRLAGMMKEAGYDACVVRGKAEAPVWISVVNDQVTFNDATDLWGLDTFECQERIWDEVTHGTAPGSWYELTKGRDGGRTTQRPSVICIGPAGENLARVSCIVHDAGHVTGQSGFGAVFGAKNLKAMSFIGSKSIPIADPAALVRLRLEVQEKFGYDIDAGKVPGAPGSPGAASTVLDTSPTVSRAEGCRGCFKNCRNLYPGGVGNELTCSAGLYFTDSGKIDEQLAAYSLLSKLGLNGYEIDMPVYLHNLYKRGVMGKGKDIDTDLPFEQYGTYAFIEELLMRIAYRREIGDDLAEGIARAAQKWGRWDEDTSSGLLARPNWGYCEHNEPRAEVEWSYGSIFSERDINEHGVHNAVYNTSIMAVLTGAEPPVSAENMAKQLADQSGLGDPLCFDWSEEGIYSDARVREIHWNRAYGRFWLQSLGMCDWVWPNFISRKHTAETGSTYGATPEYEVKFFQAVTGRDLSYEESIELGHKFWVLDRAIWALEGRHRDQEVFTNYVYDVKTTKPFPLVVFEDGKWSYSLCQGRTLDRDKFEDFKTRFYAHEGFEESTGRPTRSGLEALDLGFAADKLEAAGKLGA GT:EXON 1|1-680:0| BL:SWS:NREP 1 BL:SWS:REP 6->680|YDHV_ECOLI|2e-43|32.5|609/700| BL:PDB:NREP 1 BL:PDB:REP 5->678|1b25A|1e-38|32.8|552/611| RP:PDB:NREP 1 RP:PDB:REP 5->253|1aorA|1e-38|34.7|225/605| RP:PFM:NREP 2 RP:PFM:REP 7->231|PF02730|7e-32|41.5|200/203|AFOR_N| RP:PFM:REP 284->665|PF01314|9e-16|34.3|303/381|AFOR_C| HM:PFM:NREP 2 HM:PFM:REP 7->232|PF02730|1.1e-60|42.0|200/202|AFOR_N| HM:PFM:REP 284->665|PF01314|1.5e-27|26.9|309/382|AFOR_C| GO:PFM:NREP 5 GO:PFM GO:0016625|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor"|PF02730|IPR013983| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF02730|IPR013983| GO:PFM GO:0009055|"GO:electron carrier activity"|PF01314|IPR001203| GO:PFM GO:0016625|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor"|PF01314|IPR001203| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01314|IPR001203| RP:SCP:NREP 2 RP:SCP:REP 5->235|1aorA2|4e-51|37.2|207/210|d.152.1.1| RP:SCP:REP 461->678|1b25A1|7e-08|20.2|193/401|a.110.1.1| HM:SCP:REP 4->235|1aorA2|9.9e-48|39.4|208/210|d.152.1.1|1/1|Aldehyde ferredoxin oxidoreductase, N-terminal domain| HM:SCP:REP 236->669|1aorA1|2.1e-27|26.1|360/395|a.110.1.1|1/1|Aldehyde ferredoxin oxidoreductase, C-terminal domains| OP:NHOMO 295 OP:NHOMOORG 151 OP:PATTERN --2124----------463442241-----33------------11111-313-4453346-326--- -------------------------------------------------------------------------------122------------------------------------------------------11121---11----------------------------------------22---------------------------------------------------------------------------------------------------------------------------------------1221-1111111-1--------------4--1111-192-44311-14---2---------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------11-11-1-1----1----------------21--492-351-3211--474-42121------63---------------------------------------111---1---1--1-11-----1--------1-1----1111111111-111111-11111111111--------1-----------------11-1-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------11---2------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 598 STR:RPRED 87.9 SQ:SECSTR ####cccccEEEEEETTTTEEEEEEccHHHHHccTHHHHHHHHHHHcccTTccTTcTTccEEEEEcTTTTcccTTccTcEEEEEEcTTTccccEEEEEEcccHHHHHHHTTccEEEEEccccccEEEEEETTEEEEEEcTTTTTccHHHHHHHHHHHHHHccccE###HHHHHHTccccEcccEEEEccHHHHTTcTTccEEETTTEEEccccHHHHHHHTTEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHcTTHHGGHHHHHHHTccTTEEEccTTcccccEEEEEcTTccEHTGGGTcTEEEEccHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHTTcccccHHHTTccccccTTcHHHHHHHHHHHHTTcHHHHHHTTcHHHHHHHHT##cGGGccEETTEEccccccTTcHHHHHHHHHcTT#########ccccT##TcccHHHHHTccTTHHHHHHHHHHHHHTTHHHHHTHHHHHHcccTT#########################HHHHHHH####HHHcccc###################cHHHHHHHHHHHHHHHHHHHHHH#########TTTcccGGGGcc#cTHHHHccccc#cTTTTccccHHHHHHHHHHHHHHHTccT#TccccHHHHHHTTcTTHHHHHHTTccc## DISOP:02AL 680-681| PSIPRED ccccccccccEEEEEccccEEEEEcccHHHHHcccHHHHHHHHHHHcccccccccccccEEEEEccccccccccccccEEEEEEEccccccccEEccccHHHHHHHHHHccccEEEEEccccccEEEEEEccEEEEEEcHHHccccHHHHHHHHHHHHcccccccccHHcccccccccccccEEEEEEcHHHHccccEEEEEEccccccccccHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccccccccccccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHcccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHccccEEEEcccccccccHHccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHccHHHHHHHHHHcccccc //