[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56070.1
DDBJ      :             fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.38.5c.3.1d.168.1
:584 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   267->581 1qo8A PDBj 2e-21 31.7 %
:RPS:PDB   259->582 1e39A PDBj 5e-27 24.1 %
:RPS:SCOP  255->362 2f5tX1  b.38.5.1 * 6e-08 13.4 %
:RPS:SCOP  360->508 1d4cA3  d.168.1.1 * 3e-14 23.9 %
:HMM:SCOP  71->582 1jnrA2 c.3.1.4 * 2.4e-30 24.1 %
:RPS:PFM   239->565 PF00890 * FAD_binding_2 8e-15 36.3 %
:HMM:PFM   93->552 PF00890 * FAD_binding_2 2e-35 27.4 387/421  
:HMM:PFM   9->34 PF10399 * UCR_Fe-S_N 0.0003 46.2 26/41  
:BLT:SWISS 267->581 FRD2_SHEFN 7e-21 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56070.1 GT:GENE ACV56070.1 GT:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2479069..2480823) GB:FROM 2479069 GB:TO 2480823 GB:DIRECTION - GB:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GB:NOTE PFAM: fumarate reductase/succinate dehydrogenase flavoprotein domain protein; KEGG: shm:Shewmr7_2787 twin-arginine translocation pathway signal GB:PROTEIN_ID ACV56070.1 GB:DB_XREF GI:257475750 InterPro:IPR003953 InterPro:IPR006311 LENGTH 584 SQ:AASEQ MNNEKQKKELADGLTRRGFLTLGGVAALGAGAALAGCSPQASSASSAGDAATAASAADAAEGLAPSPWGDYYPWPANPPEITDDMVEEELDCDVAVVGLGVSGVAAFRAASEGGAKVVGIEKGSMPQQRSSQYCYLNGKLTDTFGLPHLDLEAIIKEEFQECASITNYNIVRKFVLGDAEAMDWWIEGADCEILENYEMSMDPSADVPNGVSCMSDPTIDWESEPQAAFPECLNFTDHQAVLDNNFQKGLDAGTGSEAYFGHFAEALIQNDEGRVVGVYARNADTGKYKKINAENGVCLASGCCRSNEDMVRYFAPNLIWNGNGNPWPNMDVEGNRTNTGDGYKLGYWAGASIQQYQCSQMHVMGGPGDTDSQNDSMGFTGPLLRINYNGERFMNEDTCAADAEYPIELQPKHKCFMITDSHFEENAAKCVNTFAATLAEWDERVGDGTIFKGQTLRELFESIDGMDVDAALATVERYNELCEKGVDEDYAKQAKYLMPVTDDGPYYAQRMGVGLCLVMMGGLESNQNAQVLDLERQVIPGLYASGNIQGSRFAIKYPFRLSGHSHAMAMFYGKVAGENAAAGL GT:EXON 1|1-584:0| BL:SWS:NREP 1 BL:SWS:REP 267->581|FRD2_SHEFN|7e-21|31.7|284/588| SEG 13->67|gltrrgfltlggvaalgagaalagcspqassassagdaataasaadaaeglapsp| SEG 94->106|vavvglgvsgvaa| SEG 511->523|mgvglclvmmggl| BL:PDB:NREP 1 BL:PDB:REP 267->581|1qo8A|2e-21|31.7|284/564| RP:PDB:NREP 1 RP:PDB:REP 259->582|1e39A|5e-27|24.1|294/568| RP:PFM:NREP 1 RP:PFM:REP 239->565|PF00890|8e-15|36.3|245/375|FAD_binding_2| HM:PFM:NREP 2 HM:PFM:REP 93->552|PF00890|2e-35|27.4|387/421|FAD_binding_2| HM:PFM:REP 9->34|PF10399|0.0003|46.2|26/41|UCR_Fe-S_N| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 2 RP:SCP:REP 255->362|2f5tX1|6e-08|13.4|82/92|b.38.5.1| RP:SCP:REP 360->508|1d4cA3|3e-14|23.9|134/146|d.168.1.1| HM:SCP:REP 71->582|1jnrA2|2.4e-30|24.1|311/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 252 OP:NHOMOORG 108 OP:PATTERN -------------------------------------------------------------------- --------------222----1---1------1---2243---1----------------1------------------AiC-----------------------------------------------------------------------------------------------------1-----------------------------------------111111------------------11--12-2--113112211------1------------11--------------------------1---1112-74-2------------------23-2------GA-----1-------1---------------1--------------------------------1-1--------------------------------------------------------------------------1--1212----11----------------1--11-----------------------------------------1-------------1-13-----21-2-----11--------------------------1------1-11211-3311232321421---------------32-11------------------------------11211--------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------- -------------1--------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 407 STR:RPRED 69.7 SQ:SECSTR ###############################################################################################################################################################################cccHHHHHHHHHHHHHHHHHHHTccccccTTccccEEEEEEEEEGGGTcEEEEEEEccTTcHHHHHHHHHHHTTcEEEcTcEEEccEEEEEEEEcTTccEEEEEEEETTTEEEEEEEEEEEEEEcccccTTcHHHHHHHcGHHHHHHHcGGGTTccccccTTcccHHHHHHHHTTccEEcTTcEEEEEEEETTTcccccTHHHHTTcEEEEcTTccccccTTccHHHHHHHHHTcGGGcEEEEEEHHHHHHcTHHHHHHHHTcTTHHHHHHHTcccEEccHHHHHHHHHTccHHHHHHHHHHHHHHHHTTccTTTcccccccccccccccEEEEEEEEEEEEEccEEEEccTTcEEEcTTccEEEEEEEccTTEEcccTTccccccTTHHHHHHHHHHHHHHHHHHH## PSIPRED ccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHcHHHccccccccccccccccccccccccccccccccccccccEEcccccHHHHHHHHHHHHHHccccEEEEccEEEEEEEccccEEEEEEEEEccccEEEEEEEccEEEEEcccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEccccccccccccccccccccccccccccEEEEccccccccccccccHHHHHHHHHccccEEEEEEEHHHHHHcccccccccccHHHHHHHHHccEEEEcccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEccHHcccccccccccccEEEcccccccccEEEcHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcc //