[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56091.1
DDBJ      :             ribosomal protein L1
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  909/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
e.24.1
:237 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->225 2hw8A PDBj 2e-48 53.8 %
:RPS:PDB   6->226 1ad2A PDBj 6e-60 46.6 %
:RPS:SCOP  6->226 1ad2A  e.24.1.1 * 2e-60 46.6 %
:HMM:SCOP  6->227 1ad2A_ e.24.1.1 * 1.1e-75 55.0 %
:RPS:PFM   24->219 PF00687 * Ribosomal_L1 3e-40 50.3 %
:HMM:PFM   19->220 PF00687 * Ribosomal_L1 1.5e-81 54.5 202/209  
:BLT:SWISS 3->235 RL1_KINRD 2e-71 60.9 %
:PROS 120->138|PS01199|RIBOSOMAL_L1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56091.1 GT:GENE ACV56091.1 GT:PRODUCT ribosomal protein L1 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2504897..2505610) GB:FROM 2504897 GB:TO 2505610 GB:DIRECTION - GB:PRODUCT ribosomal protein L1 GB:NOTE TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1; KEGG: ank:AnaeK_2274 ribosomal protein L1 GB:PROTEIN_ID ACV56091.1 GB:DB_XREF GI:257475771 InterPro:IPR002143 InterPro:IPR005878 LENGTH 237 SQ:AASEQ MTKLSKNYRAALEKVGEETRAPLEAMALVKEVSFAKFDETVEADFRLGIDTRQADQQLRGTVSLPNGSGKTVRVAVFAEGEAARAAEEAGADIVGTDELTQQIQAGEFNFDAAVATPDQMGKVGRLGKILGPRGLMPNPKLGTVTNDVAKAINELKGGRVEYRADRYGIAHVILGKVSFTAEQLAENYGAVYDEILRMKPAAAKGKYVKSITVSSTMSPGVKVDPSVNRNYTEPAAE GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 3->235|RL1_KINRD|2e-71|60.9|233/238| PROS 120->138|PS01199|RIBOSOMAL_L1|PDOC00922| SEG 72->91|vrvavfaegeaaraaeeaga| BL:PDB:NREP 1 BL:PDB:REP 3->225|2hw8A|2e-48|53.8|221/225| RP:PDB:NREP 1 RP:PDB:REP 6->226|1ad2A|6e-60|46.6|221/224| RP:PFM:NREP 1 RP:PFM:REP 24->219|PF00687|3e-40|50.3|193/206|Ribosomal_L1| HM:PFM:NREP 1 HM:PFM:REP 19->220|PF00687|1.5e-81|54.5|202/209|Ribosomal_L1| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF00687|IPR002143| GO:PFM GO:0006396|"GO:RNA processing"|PF00687|IPR002143| RP:SCP:NREP 1 RP:SCP:REP 6->226|1ad2A|2e-60|46.6|221/224|e.24.1.1| HM:SCP:REP 6->227|1ad2A_|1.1e-75|55.0|222/224|e.24.1.1|1/1|Ribosomal protein L1| OP:NHOMO 1053 OP:NHOMOORG 1004 OP:PATTERN ----------------------------------1--------------1----1-1111-------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1------1111111111111-1111-1111111111111111111-1-111--11111111----1-1--1--1------11-11-1----11---11-1--3----------------------------------------------------------------112222Q1-2223234132112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 95.4 SQ:SECSTR ccccccccTTTTTcccTTcccHHHHHHHHHTTcccccccEEEEEEEEcccTTcGGGccEEEEEccccccTTccEEEEccTHHHHHHHHTTccEEEcGGGHHHHHTTcccccEEEEcGGGHHHHHHHHHHHHHHTccccTTTTcccccHHHHHHHHHTTEEEEEccTTcEEEEEEEETTccHHHHHHHHHHHHHHHHTTccTTcccccEEEEEEEcTTcccEEEcTT########### PSIPRED cccHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccEEEEEEEccccccccccEEEEEEcccccccccEEEEEccHHHHHHHHHccccEEcHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccEEEcHHHHHHHHHHccc //