[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56092.1
DDBJ      :             ribosomal protein L11
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  910/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
a.4.7d.47.1
:166 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->140 2k3fA PDBj 2e-35 51.1 %
:RPS:PDB   4->141 3bboK PDBj 4e-34 49.3 %
:RPS:SCOP  34->70 1mmsA2  d.47.1.1 * 2e-11 70.3 %
:RPS:SCOP  68->141 1hc8A  a.4.7.1 * 3e-22 62.2 %
:HMM:SCOP  2->85 1wibA_ d.47.1.1 * 9.4e-29 45.1 %
:HMM:SCOP  68->141 1hc8A_ a.4.7.1 * 2.6e-25 56.8 %
:RPS:PFM   10->67 PF03946 * Ribosomal_L11_N 9e-08 41.4 %
:RPS:PFM   72->140 PF00298 * Ribosomal_L11 2e-14 58.0 %
:HMM:PFM   9->67 PF03946 * Ribosomal_L11_N 5.7e-33 67.8 59/60  
:HMM:PFM   72->140 PF00298 * Ribosomal_L11 1.2e-29 53.6 69/69  
:BLT:SWISS 3->142 RL11_STRSF 2e-40 68.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56092.1 GT:GENE ACV56092.1 GT:PRODUCT ribosomal protein L11 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2505725..2506225) GB:FROM 2505725 GB:TO 2506225 GB:DIRECTION - GB:PRODUCT ribosomal protein L11 GB:NOTE KEGG: gbm:Gbem_0922 ribosomal protein L11; TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein L11; SMART: ribosomal protein L11 GB:PROTEIN_ID ACV56092.1 GB:DB_XREF GI:257475772 InterPro:IPR000911 InterPro:IPR006519 LENGTH 166 SQ:AASEQ MAEKKQTGFIKLQIPAGAANPAPPVGPALGAQGVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFVCKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRIEGREMKIKYVPSKKVAAMLQGKTLED GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 3->142|RL11_STRSF|2e-40|68.6|140/144| SEG 15->33|pagaanpappvgpalgaqg| BL:PDB:NREP 1 BL:PDB:REP 4->140|2k3fA|2e-35|51.1|137/141| RP:PDB:NREP 1 RP:PDB:REP 4->141|3bboK|4e-34|49.3|138/145| RP:PFM:NREP 2 RP:PFM:REP 10->67|PF03946|9e-08|41.4|58/60|Ribosomal_L11_N| RP:PFM:REP 72->140|PF00298|2e-14|58.0|69/69|Ribosomal_L11| HM:PFM:NREP 2 HM:PFM:REP 9->67|PF03946|5.7e-33|67.8|59/60|Ribosomal_L11_N| HM:PFM:REP 72->140|PF00298|1.2e-29|53.6|69/69|Ribosomal_L11| GO:PFM:NREP 6 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03946|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF03946|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF03946|IPR000911| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 2 RP:SCP:REP 34->70|1mmsA2|2e-11|70.3|37/63|d.47.1.1| RP:SCP:REP 68->141|1hc8A|3e-22|62.2|74/74|a.4.7.1| HM:SCP:REP 2->85|1wibA_|9.4e-29|45.1|82/0|d.47.1.1|1/1|Ribosomal L11/L12e N-terminal domain| HM:SCP:REP 68->141|1hc8A_|2.6e-25|56.8|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 1091 OP:NHOMOORG 1040 OP:PATTERN --1-11-1-1------1------1111111111111111111111111111111111111111-1-11 1111111111111111111-11111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111311111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------------111------11--------------1-1-11--------------------111111-1111111-1111111-11-111-1-1111-1--1----3--------------------232-1--1---1-1111----1------1-----1---111----12222G222124224-32-131112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 83.7 SQ:SECSTR ###cccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGcccccccEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEcc######################## PSIPRED ccccEEEEEEEEEEEccccccccccHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEEEEcccEEEEEEccccHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHccHHccc //