[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56101.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->52 PF11163 * DUF2947 0.00039 18.0 50/153  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56101.1 GT:GENE ACV56101.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2513847..2514029) GB:FROM 2513847 GB:TO 2514029 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56101.1 GB:DB_XREF GI:257475781 LENGTH 60 SQ:AASEQ MPIPDPRANEKKETYISRCMEHITRYEKDKFPDQDQRAAICYSTWDRWQKDHGHPEKAEK GT:EXON 1|1-60:0| HM:PFM:NREP 1 HM:PFM:REP 2->52|PF11163|0.00039|18.0|50/153|DUF2947| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-53,59-61| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHcc //