[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56123.1
DDBJ      :             ribosomal protein L30
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  213/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.59.1
:63 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->62 1vs6Y PDBj 1e-09 47.4 %
:RPS:PDB   7->63 1bxyA PDBj 2e-15 42.1 %
:RPS:SCOP  7->63 1bxyA  d.59.1.1 * 1e-15 42.1 %
:HMM:SCOP  5->64 1bxyA_ d.59.1.1 * 6.2e-18 60.0 %
:RPS:PFM   8->58 PF00327 * Ribosomal_L30 7e-07 54.9 %
:HMM:PFM   7->58 PF00327 * Ribosomal_L30 1.3e-22 44.2 52/52  
:BLT:SWISS 8->63 RL30_CHLSY 7e-17 66.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56123.1 GT:GENE ACV56123.1 GT:PRODUCT ribosomal protein L30 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2544540..2544731) GB:FROM 2544540 GB:TO 2544731 GB:DIRECTION - GB:PRODUCT ribosomal protein L30 GB:NOTE TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein L30; KEGG: rru:Rru_A2670 50S ribosomal protein L30 GB:PROTEIN_ID ACV56123.1 GB:DB_XREF GI:257475803 InterPro:IPR000517 InterPro:IPR005996 LENGTH 63 SQ:AASEQ MADAKKTLRITQVKSSIGYKEDQGKTLRALGLGKINRSVEQVDNESVRGMIFKVKHLVKVEEI GT:EXON 1|1-63:0| BL:SWS:NREP 1 BL:SWS:REP 8->63|RL30_CHLSY|7e-17|66.1|56/65| BL:PDB:NREP 1 BL:PDB:REP 6->62|1vs6Y|1e-09|47.4|57/58| RP:PDB:NREP 1 RP:PDB:REP 7->63|1bxyA|2e-15|42.1|57/60| RP:PFM:NREP 1 RP:PFM:REP 8->58|PF00327|7e-07|54.9|51/52|Ribosomal_L30| HM:PFM:NREP 1 HM:PFM:REP 7->58|PF00327|1.3e-22|44.2|52/52|Ribosomal_L30| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00327|IPR000517| GO:PFM GO:0005622|"GO:intracellular"|PF00327|IPR000517| GO:PFM GO:0005840|"GO:ribosome"|PF00327|IPR000517| GO:PFM GO:0006412|"GO:translation"|PF00327|IPR000517| RP:SCP:NREP 1 RP:SCP:REP 7->63|1bxyA|1e-15|42.1|57/60|d.59.1.1| HM:SCP:REP 5->64|1bxyA_|6.2e-18|60.0|60/60|d.59.1.1|1/1|Ribosomal protein L30p/L7e| OP:NHOMO 213 OP:NHOMOORG 213 OP:PATTERN -------------------------------------------------------------------- ---11-------11-------1--11-----11-1-1-11-11111-1111------1--11--11-111--------11111-----111--1------1---1--1-----------------111111111-11111111111-----------------------------------------------1---------------111111---111----111111--111111111111111-11-11-------------------------11111111111111111111111111111111111111111111-1-------------1-11------------1-1111----1-----------------------------------------------------------------------1-1-------------------11---11------------111111111-111-------1-----------------------------------------------------------------------11-1----------------------------1----------------------------------11-1-------1111--1--1--1-------------------1-------------------------------------------------------------------------------1-----------1-----1-1-1111-111---------------------------------------1--11111111-11---------------------------------------------------------------11111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 92.1 SQ:SECSTR #####cEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEEEE PSIPRED ccccccEEEEEEEcccccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHEEEEEc //