[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56124.1
DDBJ      :             ribosomal protein S5
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  909/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.50.1
:175 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->162 1vs5E PDBj 2e-35 48.3 %
:RPS:PDB   13->162 3d5aE PDBj 7e-36 40.9 %
:RPS:SCOP  13->79 1fjgE2  d.50.1.2 * 9e-12 32.8 %
:RPS:SCOP  84->161 1fjgE1  d.14.1.1 * 4e-17 50.0 %
:HMM:SCOP  13->81 1fjgE2 d.50.1.2 * 2.8e-24 59.4 %
:HMM:SCOP  83->163 1fjgE1 d.14.1.1 * 6.5e-26 54.3 %
:RPS:PFM   14->79 PF00333 * Ribosomal_S5 4e-10 51.5 %
:RPS:PFM   89->161 PF03719 * Ribosomal_S5_C 4e-15 56.2 %
:HMM:PFM   89->162 PF03719 * Ribosomal_S5_C 9.3e-34 59.5 74/74  
:HMM:PFM   13->78 PF00333 * Ribosomal_S5 1.6e-31 62.1 66/67  
:BLT:SWISS 8->170 RS5_PELTS 5e-47 56.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56124.1 GT:GENE ACV56124.1 GT:PRODUCT ribosomal protein S5 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2544731..2545258) GB:FROM 2544731 GB:TO 2545258 GB:DIRECTION - GB:PRODUCT ribosomal protein S5 GB:NOTE TIGRFAM: ribosomal protein S5; PFAM: Ribosomal protein S5 ; ribosomal protein S5 domain protein; KEGG: bha:BH0151 30S ribosomal protein S5 GB:PROTEIN_ID ACV56124.1 GB:DB_XREF GI:257475804 InterPro:IPR005324 InterPro:IPR005712 InterPro:IPR013810 LENGTH 175 SQ:AASEQ MARNKQDNAAVPELQERVVYINRVSKVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPIAIKKGVEDAKKNMFSVPLTAEKTLPHEIIGEYGAGRVLIKPATPGTGVIAGGAARAVMELAGVTDCFAKSLGTDNVMNVVKATAEGLKSMESPEQVSERRGMSVSKIYGWKEKN GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 8->170|RS5_PELTS|5e-47|56.2|162/166| SEG 40->54|vvvgdgngrvgvgmg| BL:PDB:NREP 1 BL:PDB:REP 13->162|1vs5E|2e-35|48.3|149/150| RP:PDB:NREP 1 RP:PDB:REP 13->162|3d5aE|7e-36|40.9|149/151| RP:PFM:NREP 2 RP:PFM:REP 14->79|PF00333|4e-10|51.5|66/67|Ribosomal_S5| RP:PFM:REP 89->161|PF03719|4e-15|56.2|73/74|Ribosomal_S5_C| HM:PFM:NREP 2 HM:PFM:REP 89->162|PF03719|9.3e-34|59.5|74/74|Ribosomal_S5_C| HM:PFM:REP 13->78|PF00333|1.6e-31|62.1|66/67|Ribosomal_S5| GO:PFM:NREP 9 GO:PFM GO:0003723|"GO:RNA binding"|PF00333|IPR013810| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00333|IPR013810| GO:PFM GO:0005622|"GO:intracellular"|PF00333|IPR013810| GO:PFM GO:0005840|"GO:ribosome"|PF00333|IPR013810| GO:PFM GO:0006412|"GO:translation"|PF00333|IPR013810| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03719|IPR005324| GO:PFM GO:0005622|"GO:intracellular"|PF03719|IPR005324| GO:PFM GO:0005840|"GO:ribosome"|PF03719|IPR005324| GO:PFM GO:0006412|"GO:translation"|PF03719|IPR005324| RP:SCP:NREP 2 RP:SCP:REP 13->79|1fjgE2|9e-12|32.8|67/69|d.50.1.2| RP:SCP:REP 84->161|1fjgE1|4e-17|50.0|78/81|d.14.1.1| HM:SCP:REP 13->81|1fjgE2|2.8e-24|59.4|69/69|d.50.1.2|1/1|dsRNA-binding domain-like| HM:SCP:REP 83->163|1fjgE1|6.5e-26|54.3|81/81|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1028 OP:NHOMOORG 978 OP:PATTERN 1111-11-----------11--111--1-11-111-111111-111111-111---------11---- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------1-----11------------------------------------------------------------------------1----------1-1--1345-1------------------------------------------------------------------21112P332211143-211211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 96.0 SQ:SECSTR ccEEEEEE###cccEEEEEEEEEEEccccccccEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHcccccccccTTcccccEEEEETTEEEEEEEccTTcEEEccHHHHHHHHTTTccEEEEEEEEcccHHHHHHHHHHHHHHcccHHHHHHHHHccccccc#cc### PSIPRED ccccccccccccccEEEEEEEccccEEEcccEEEEEEEEEEEEcccccEEEEEcccccccHHHHHHHHHHHccEEEEEEccccEEEEEEEEEEccEEEEEEEcccccEEEEccHHHHHHHHHccccccHHccccccHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHcccccc //