[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56128.1
DDBJ      :             ribosomal protein S14
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  774/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->61 2j00N PDBj 3e-22 66.7 %
:RPS:PDB   9->61 3bbnN PDBj 4e-15 41.5 %
:RPS:SCOP  2->61 1fjgN  g.39.1.7 * 6e-22 66.7 %
:HMM:SCOP  2->61 1fjgN_ g.39.1.7 * 2.5e-22 50.0 %
:RPS:PFM   18->60 PF00253 * Ribosomal_S14 5e-10 69.8 %
:HMM:PFM   10->60 PF00253 * Ribosomal_S14 5.6e-28 56.9 51/55  
:BLT:SWISS 1->61 RS14Z_SYNAS 1e-25 72.1 %
:PROS 23->45|PS00527|RIBOSOMAL_S14

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56128.1 GT:GENE ACV56128.1 GT:PRODUCT ribosomal protein S14 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2546742..2546927) GB:FROM 2546742 GB:TO 2546927 GB:DIRECTION - GB:PRODUCT ribosomal protein S14 GB:NOTE PFAM: ribosomal protein S14; KEGG: sat:SYN_03315 30S ribosomal protein S14 GB:PROTEIN_ID ACV56128.1 GB:DB_XREF GI:257475808 InterPro:IPR001209 LENGTH 61 SQ:AASEQ MAKKSMVAKAKREPKFSTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKASW GT:EXON 1|1-61:0| BL:SWS:NREP 1 BL:SWS:REP 1->61|RS14Z_SYNAS|1e-25|72.1|61/61| PROS 23->45|PS00527|RIBOSOMAL_S14|PDOC00456| BL:PDB:NREP 1 BL:PDB:REP 2->61|2j00N|3e-22|66.7|60/60| RP:PDB:NREP 1 RP:PDB:REP 9->61|3bbnN|4e-15|41.5|53/99| RP:PFM:NREP 1 RP:PFM:REP 18->60|PF00253|5e-10|69.8|43/55|Ribosomal_S14| HM:PFM:NREP 1 HM:PFM:REP 10->60|PF00253|5.6e-28|56.9|51/55|Ribosomal_S14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00253|IPR001209| GO:PFM GO:0005622|"GO:intracellular"|PF00253|IPR001209| GO:PFM GO:0005840|"GO:ribosome"|PF00253|IPR001209| GO:PFM GO:0006412|"GO:translation"|PF00253|IPR001209| RP:SCP:NREP 1 RP:SCP:REP 2->61|1fjgN|6e-22|66.7|60/60|g.39.1.7| HM:SCP:REP 2->61|1fjgN_|2.5e-22|50.0|60/60|g.39.1.7|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 831 OP:NHOMOORG 776 OP:PATTERN -------------------------------------------------------------------- 11111-1111111121111-12112211111221112122111121111-----------11112121121111121111111111111111-111---1111111111111111111111111-11111-11--1-11111111-1111--111111111111111---111111111111111111111112111111111111111113322111111111122222211111111111111111111121-11211212211222111211-11111122221111111111111122222222212221--1111111111111111111111111111111-11111-111111-1111111111-1111111111111-------------1111111111--11111111111-111111111111-1--111111111111111111111111-11111-----1111---------1--11111-11111111111111111111111111111111111111111111111111111111111-1111-11111-1-111-1111-11111111-1111111111111111111111111111--111111-1-111111111-11111-1111111111111111111--1-11111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111--111111111111--1111111-11-11111-------11-111111-111-----1---1111111111111------11111--------------111-1-121111111111111---11-111-1111111-11111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 98.4 SQ:SECSTR #ccHHHHHccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTcccccccccc DISOP:02AL 61-62| PSIPRED ccHHHHHHHHHHccccHHHHcccEEEcccccEEcccccHHHHHHHHHHHcccccccEEccc //