[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56132.1
DDBJ      :             ribosomal protein S17
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  880/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:86 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->85 1ripA PDBj 1e-21 61.5 %
:RPS:PDB   8->85 3d5aQ PDBj 1e-22 47.4 %
:RPS:SCOP  9->85 1vs5Q1  b.40.4.5 * 1e-23 53.2 %
:HMM:SCOP  7->86 1i94Q_ b.40.4.5 * 1.7e-27 53.8 %
:RPS:PFM   13->81 PF00366 * Ribosomal_S17 8e-15 60.9 %
:HMM:PFM   13->81 PF00366 * Ribosomal_S17 9.1e-29 50.7 69/69  
:BLT:SWISS 4->86 RS17_PORGI 3e-27 62.7 %
:PROS 59->71|PS00056|RIBOSOMAL_S17

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56132.1 GT:GENE ACV56132.1 GT:PRODUCT ribosomal protein S17 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2548466..2548726) GB:FROM 2548466 GB:TO 2548726 GB:DIRECTION - GB:PRODUCT ribosomal protein S17 GB:NOTE PFAM: ribosomal protein S17; KEGG: bsu:BSU01250 30S ribosomal protein S17 GB:PROTEIN_ID ACV56132.1 GB:DB_XREF GI:257475812 InterPro:IPR000266 LENGTH 86 SQ:AASEQ MSEERNSRKVRQGVVVSAVNDKTCVVQVKERKPHPVYGKMMTTTKKFHAHDENNEAGLGDTVQIMETRPLSKMKRWRLVKIVEKAQ GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 4->86|RS17_PORGI|3e-27|62.7|83/84| PROS 59->71|PS00056|RIBOSOMAL_S17|PDOC00055| BL:PDB:NREP 1 BL:PDB:REP 8->85|1ripA|1e-21|61.5|78/81| RP:PDB:NREP 1 RP:PDB:REP 8->85|3d5aQ|1e-22|47.4|78/99| RP:PFM:NREP 1 RP:PFM:REP 13->81|PF00366|8e-15|60.9|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 13->81|PF00366|9.1e-29|50.7|69/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 9->85|1vs5Q1|1e-23|53.2|77/80|b.40.4.5| HM:SCP:REP 7->86|1i94Q_|1.7e-27|53.8|80/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 920 OP:NHOMOORG 895 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111112-11-111111111111111111111111-11111111111112-1111111111-11111111111111111111111111111---11111--111111111111111-----1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-1-------11-11111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ---------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------11-1G-11223112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 91.9 SQ:SECSTR #######ccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEccc PSIPRED ccccccccEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEEEEEEEEEccccccccccEEEEEEEccccccEEEEEEEEEEEcc //