[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56136.1
DDBJ      :             ribosomal protein L22
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  890/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
d.55.1
:113 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->110 2j01W PDBj 8e-34 60.0 %
:RPS:PDB   1->111 3d5bW PDBj 1e-29 59.5 %
:RPS:SCOP  2->110 1bxeA  d.55.1.1 * 4e-35 59.6 %
:HMM:SCOP  1->110 1bxeA_ d.55.1.1 * 7e-35 50.0 %
:RPS:PFM   7->107 PF00237 * Ribosomal_L22 1e-17 49.5 %
:HMM:PFM   5->108 PF00237 * Ribosomal_L22 4.9e-40 52.9 104/105  
:BLT:SWISS 2->112 RL22_DESHD 2e-34 61.3 %
:PROS 1->74|PS00430|TONB_DEPENDENT_REC_1
:PROS 83->107|PS00464|RIBOSOMAL_L22

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56136.1 GT:GENE ACV56136.1 GT:PRODUCT ribosomal protein L22 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2550090..2550431) GB:FROM 2550090 GB:TO 2550431 GB:DIRECTION - GB:PRODUCT ribosomal protein L22 GB:NOTE TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein L22/L17; KEGG: bha:BH0139 50S ribosomal protein L22 GB:PROTEIN_ID ACV56136.1 GB:DB_XREF GI:257475816 InterPro:IPR001063 InterPro:IPR005727 InterPro:IPR010916 LENGTH 113 SQ:AASEQ MEAKAIARYVRVSPRKARIVIDLIRGKSVPAAREILQFSDRAIAEVVAKTLNSAVANAENQHHVRPETLIVKAAFADEGPTLKRIRPRAKGSASRIRKRTSHITIIVAPREEA GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 2->112|RL22_DESHD|2e-34|61.3|111/114| PROS 1->74|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| PROS 83->107|PS00464|RIBOSOMAL_L22|PDOC00387| BL:PDB:NREP 1 BL:PDB:REP 1->110|2j01W|8e-34|60.0|110/113| RP:PDB:NREP 1 RP:PDB:REP 1->111|3d5bW|1e-29|59.5|111/112| RP:PFM:NREP 1 RP:PFM:REP 7->107|PF00237|1e-17|49.5|101/105|Ribosomal_L22| HM:PFM:NREP 1 HM:PFM:REP 5->108|PF00237|4.9e-40|52.9|104/105|Ribosomal_L22| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00237|IPR001063| GO:PFM GO:0005622|"GO:intracellular"|PF00237|IPR001063| GO:PFM GO:0005840|"GO:ribosome"|PF00237|IPR001063| GO:PFM GO:0006412|"GO:translation"|PF00237|IPR001063| RP:SCP:NREP 1 RP:SCP:REP 2->110|1bxeA|4e-35|59.6|109/110|d.55.1.1| HM:SCP:REP 1->110|1bxeA_|7e-35|50.0|110/110|d.55.1.1|1/1|Ribosomal protein L22| OP:NHOMO 921 OP:NHOMOORG 908 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111-111111111111111111111111111--111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211--------1-111111-11111111111111111111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111821-21-112-11--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 99.1 SQ:SECSTR cccEEEEEEEEccHHHHHHHHHHTTTccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccGGGEEEEEEEEEEEEEEEcccEETTTEEcccEEEEEEEEEEEEEccc# PSIPRED ccEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHcEEEEEEEcccccccccccccccccccEEcccccEEEEEEEcccc //