[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56137.1
DDBJ      :             ribosomal protein S19
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  901/915 : Eukaryota  77/199 : Viruses  0/175   --->[See Alignment]
d.28.1
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->86 1ibmS PDBj 2e-33 67.9 %
:RPS:PDB   1->91 3bbnS PDBj 7e-33 60.4 %
:RPS:SCOP  3->83 1fjgS  d.28.1.1 * 7e-30 70.4 %
:HMM:SCOP  2->85 1fjgS_ d.28.1.1 * 8.7e-33 59.5 %
:RPS:PFM   3->83 PF00203 * Ribosomal_S19 3e-27 74.1 %
:HMM:PFM   3->83 PF00203 * Ribosomal_S19 2e-41 64.2 81/81  
:BLT:SWISS 1->87 RS19_DESHD 2e-40 79.3 %
:PROS 53->77|PS00323|RIBOSOMAL_S19

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56137.1 GT:GENE ACV56137.1 GT:PRODUCT ribosomal protein S19 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2550447..2550722) GB:FROM 2550447 GB:TO 2550722 GB:DIRECTION - GB:PRODUCT ribosomal protein S19 GB:NOTE TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein S19/S15; KEGG: bha:BH0138 30S ribosomal protein S19 GB:PROTEIN_ID ACV56137.1 GB:DB_XREF GI:257475817 InterPro:IPR002222 InterPro:IPR005732 LENGTH 91 SQ:AASEQ MSRSLKKGPFVEPRLLDRIEKMNAAGEKNVVKTWSRSSTIFPEMVGHTIAVHDGRKHVPVYVTESMVGHKLGEFAPTRTFKGHSADKGKKR GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|RS19_DESHD|2e-40|79.3|87/93| PROS 53->77|PS00323|RIBOSOMAL_S19|PDOC00288| BL:PDB:NREP 1 BL:PDB:REP 3->86|1ibmS|2e-33|67.9|84/87| RP:PDB:NREP 1 RP:PDB:REP 1->91|3bbnS|7e-33|60.4|91/92| RP:PFM:NREP 1 RP:PFM:REP 3->83|PF00203|3e-27|74.1|81/81|Ribosomal_S19| HM:PFM:NREP 1 HM:PFM:REP 3->83|PF00203|2e-41|64.2|81/81|Ribosomal_S19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00203|IPR002222| GO:PFM GO:0005622|"GO:intracellular"|PF00203|IPR002222| GO:PFM GO:0005840|"GO:ribosome"|PF00203|IPR002222| GO:PFM GO:0006412|"GO:translation"|PF00203|IPR002222| RP:SCP:NREP 1 RP:SCP:REP 3->83|1fjgS|7e-30|70.4|81/84|d.28.1.1| HM:SCP:REP 2->85|1fjgS_|8.7e-33|59.5|84/84|d.28.1.1|1/1|Ribosomal protein S19| OP:NHOMO 1021 OP:NHOMOORG 1005 OP:PATTERN 111111-1--------1-111111-----1--11----------------11--1111111---1--- 1111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11-111-1-1-----1-----111-111111---1111-1-1--1-111111-11111111111111111111111-1111-1411111-1111--------------------------------------------------------------------1111--------1-9112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 100.0 SQ:SECSTR ccccccccccccHHHHHHHHTTTTTTccccEEEccccccccTTcTTccEEEEccccEEEEcccccccccccTTTccccccccccccccccc DISOP:02AL 91-92| PSIPRED ccccccccccccHHHHHHHHHHHHccccccEEEEccccEEcHHHcccEEEEEcccEEEEEEEccccEEcccccccccEEEEcccccccccc //