[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56163.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  755/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   188->271 3dhwA PDBj 7e-05 31.6 %
:RPS:PDB   246->276 3dhwA PDBj 2e-05 32.3 %
:RPS:SCOP  130->344 2r6gG1  f.58.1.1 * 6e-22 15.1 %
:HMM:PFM   168->348 PF00528 * BPD_transp_1 9.1e-26 32.0 169/185  
:BLT:SWISS 123->348 GSID_SALTY 5e-30 32.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56163.1 GT:GENE ACV56163.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2585112..2586173) GB:FROM 2585112 GB:TO 2586173 GB:DIRECTION - GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:NOTE PFAM: binding-protein-dependent transport systems inner membrane component; KEGG: dde:Dde_1327 dipeptide ABC transporter, permease protein GB:PROTEIN_ID ACV56163.1 GB:DB_XREF GI:257475843 InterPro:IPR000515 LENGTH 353 SQ:AASEQ MADERVETCLTCESAVGFGSSQSLGSPGSHETPTGRFGSMGAAPRSEAQQVPEGETRLVGTAEPNGSKDAAPPLLHAPRAARVGNRRLTLAAFLGALAALAAVVVAGLVVADAATATDFSMKNLAPSFAHPFGTDWMGRDMLLRTLAGLSTSVLVGLLAAGVSSIIALVMGAVAALGGKKADAAVTWLIDLMLGIPHIVLLILISFALGKGFWGVTIGVAVTHWPSLARVVRAEILQCKQSTFVAAARRLGQTPLRIAAKHMVPYVLPQFIVGLILLFPHAILHEAAVTFLGFGLPPEQPAIGVILSESMAYLSAGMWWLAVFPGLALIATVLLFDLAGSSLRKLVDPHSAQE GT:EXON 1|1-353:0| BL:SWS:NREP 1 BL:SWS:REP 123->348|GSID_SALTY|5e-30|32.0|225/303| TM:NTM 5 TM:REGION 92->114| TM:REGION 148->170| TM:REGION 192->214| TM:REGION 264->286| TM:REGION 317->339| SEG 70->82|aappllhapraar| SEG 90->119|laaflgalaalaavvvaglvvadaatatdf| SEG 167->185|alvmgavaalggkkadaav| BL:PDB:NREP 1 BL:PDB:REP 188->271|3dhwA|7e-05|31.6|79/203| RP:PDB:NREP 1 RP:PDB:REP 246->276|3dhwA|2e-05|32.3|31/203| HM:PFM:NREP 1 HM:PFM:REP 168->348|PF00528|9.1e-26|32.0|169/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 130->344|2r6gG1|6e-22|15.1|212/284|f.58.1.1| OP:NHOMO 3218 OP:NHOMOORG 816 OP:PATTERN 4441313244443341223332113335415212---1-----1-3-52-C95-54432131113-11 11-4B453344-5123322-2311292222224333256719-76C95365258532411552395577833222633324-311111--------2--------11--11111111111111111111111112135595221693322333222211111132215322111111111111A5422771423666664564546445A76663655324C421222222E6155555555655556333221122331--1-11--33111111112333333311112211111112222222222222231122211111C362444344414222221111531339-1-1BA631-282-2251163311----112113-FGM--47439-AAAAA997AAK-2392392CNL1-iOOUFG9TQIMMI4-115ACA6AA5AA--------21122-19--------------------------------1-1CEB9C57777544444558855552566C64A7113342343343C5CS231132242-------111211336122352233331111111211----14111-11-11111112212221112-1211552121-1-151----111111-111--21--13311------66JC3856666666666-66666666666666666659A9B92255555555555545455866556463-444444443444---11-1-11111-1746222-1222221312222222121133133233547264442ABA1----1---146646666645688--1-------------12111111111111116-1112-1----1-1-111----1-111436549E977212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1---1-------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 23.8 SQ:SECSTR ###########################################################################################################################################################################################HHHHHHHccHHHHHHHHcccHHHHHHHHHHHHH####HHHHHHHHHHHHHccTT#TTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHH############################################################################# DISOP:02AL 17-17,20-20,25-25,353-354| PSIPRED ccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHccccHHHHHHHcccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccc //