[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56189.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->156 PF06139 * BphX 0.00013 27.3 110/136  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56189.1 GT:GENE ACV56189.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2615724..2616227) GB:FROM 2615724 GB:TO 2616227 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56189.1 GB:DB_XREF GI:257475869 LENGTH 167 SQ:AASEQ MTASGVKDMVEAADSRAEPQSVGENGAPMTIWQVWLRRLCLFVIVWAIAEVLLGAALWGAYLFARMVLDVEPSVLAEPVVGAMAMAGACLNLAIGFLGLRGARNPRKITLFFWITFVDAMLTAWALASSVSAGTCDLTSLVSGLFVIALAVCAWQVRGQTGYFDAHP GT:EXON 1|1-167:0| TM:NTM 4 TM:REGION 43->65| TM:REGION 78->99| TM:REGION 108->130| TM:REGION 135->156| HM:PFM:NREP 1 HM:PFM:REP 45->156|PF06139|0.00013|27.3|110/136|BphX| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-26,31-32,34-34,39-39,123-123,129-130,132-132,137-137,143-143| PSIPRED ccHHHHHHHHHHHHccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccc //