[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56239.1
DDBJ      :             RNA polymerase, sigma-24 subunit, ECF subfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.1a.4.13
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->143 1or7A PDBj 2e-07 31.1 %
:RPS:PDB   11->150 3dxjF PDBj 3e-15 16.4 %
:RPS:SCOP  11->83 1iw7F3  a.177.1.1 * 1e-13 17.8 %
:RPS:SCOP  110->150 1k78A1  a.4.1.5 * 5e-06 26.8 %
:HMM:SCOP  7->80 1h3lA_ a.177.1.1 * 8.1e-17 36.5 %
:HMM:SCOP  110->166 1s7oA_ a.4.13.3 * 2.5e-11 43.9 %
:RPS:PFM   18->83 PF04542 * Sigma70_r2 5e-05 39.4 %
:RPS:PFM   115->150 PF08281 * Sigma70_r4_2 9e-04 38.9 %
:HMM:PFM   18->83 PF04542 * Sigma70_r2 2.9e-18 47.0 66/71  
:HMM:PFM   110->161 PF08281 * Sigma70_r4_2 2.7e-14 34.6 52/54  
:BLT:SWISS 1->145 SIGW_BACSU 4e-08 31.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56239.1 GT:GENE ACV56239.1 GT:PRODUCT RNA polymerase, sigma-24 subunit, ECF subfamily GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2677946..2678461) GB:FROM 2677946 GB:TO 2678461 GB:DIRECTION - GB:PRODUCT RNA polymerase, sigma-24 subunit, ECF subfamily GB:NOTE TIGRFAM: RNA polymerase sigma factor, sigma-70 family; PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4 type 2; sigma-70 region 4 domain protein; KEGG: acp:A2cp1_2267 RNA polymerase, sigma-24 subunit, ECF subfamily GB:PROTEIN_ID ACV56239.1 GB:DB_XREF GI:257475919 InterPro:IPR007627 InterPro:IPR007630 InterPro:IPR013249 InterPro:IPR014284 LENGTH 171 SQ:AASEQ MKRGLKNRLRDGEAFDRLVEEHYDDVLAYCRRHAPSYDDAPDVAQEAFLRFVRSGRSPRDGKPLAYLFTIARNLCIDAARARRLPVGPLDVDVPDGSPDADPAMAIGGGEVDALVDALPPELRDVVELRFDQGFKVGEIADVLGVSRFAVNRRLNRALAELRRGLEGKDEA GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 1->145|SIGW_BACSU|4e-08|31.9|144/187| SEG 151->167|nrrlnralaelrrgleg| BL:PDB:NREP 1 BL:PDB:REP 11->143|1or7A|2e-07|31.1|132/181| RP:PDB:NREP 1 RP:PDB:REP 11->150|3dxjF|3e-15|16.4|140/349| RP:PFM:NREP 2 RP:PFM:REP 18->83|PF04542|5e-05|39.4|66/70|Sigma70_r2| RP:PFM:REP 115->150|PF08281|9e-04|38.9|36/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 18->83|PF04542|2.9e-18|47.0|66/71|Sigma70_r2| HM:PFM:REP 110->161|PF08281|2.7e-14|34.6|52/54|Sigma70_r4_2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 11->83|1iw7F3|1e-13|17.8|73/184|a.177.1.1| RP:SCP:REP 110->150|1k78A1|5e-06|26.8|41/63|a.4.1.5| HM:SCP:REP 7->80|1h3lA_|8.1e-17|36.5|74/75|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 110->166|1s7oA_|2.5e-11|43.9|57/0|a.4.13.3|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 74 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- --3-----1111---1111-1111111111111111-1----------------------111-11--1-----------12-------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1----111--11-1-1-------------11-----------11------------------------------1--11----------1--1---------------------------------------------------------1--------1111-----------------1----------------1---------------------2---------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12-----1----------------------------------------------------------------------------------------------------------2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 81.9 SQ:SECSTR ##########HHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGG##################### DISOP:02AL 171-172| PSIPRED ccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccc //