[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56252.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:SWISS 104->169 CADM4_HUMAN 7e-04 34.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56252.1 GT:GENE ACV56252.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2697347..2698120) GB:FROM 2697347 GB:TO 2698120 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: afw:Anae109_0249 hypothetical protein GB:PROTEIN_ID ACV56252.1 GB:DB_XREF GI:257475932 LENGTH 257 SQ:AASEQ MMLNYTKSELYRIVHGRELYLFTGVLCAIVLLSSVLLWAMASTPDFPYATVRFSLSNLISMLPSLFLLAGLLVWVLFADDRKDGTFKNAVADGCSRRDLFVGKCLVSTGLGLASMMVILAVYVGSAVLLLEGPADAVPILLKGVAAALPFTVACVVLGVAVCSVLPKTSAAFLVWLAIVAIVPSALHAVGMVVEPVGALASWLPYNFFSNEVAINQSGLAEFLWDTPAGLAKCLIAGFAGVAVFGIAGLWRASKREL GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 104->169|CADM4_HUMAN|7e-04|34.4|64/100| TM:NTM 5 TM:REGION 20->42| TM:REGION 56->78| TM:REGION 104->126| TM:REGION 159->181| TM:REGION 229->251| SEG 65->78|lfllagllvwvlfa| SEG 235->248|iagfagvavfgiag| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 26.1 SQ:SECSTR ###############################################################################################################################HHHcccEEEE#EccccGGGHHHHHHHHHHTTccEEEEETTcTTHHHHHHHHHHHcTTcEEEEEccccH############################################################## DISOP:02AL 87-88,90-90,95-95,101-102,104-104,179-179,185-186,188-188,193-194,199-200,202-202,207-207| PSIPRED cccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //