[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56274.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.1.1a.4.1
:220 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   18->81 3dcfB PDBj 3e-04 31.2 %
:RPS:PDB   20->209 1bjzA PDBj 6e-09 11.2 %
:RPS:SCOP  20->82 1z77A1  a.4.1.9 * 1e-07 23.8 %
:RPS:SCOP  67->179 1b8dA  a.1.1.3 * 1e-04 15.4 %
:HMM:SCOP  12->87 2fd5A1 a.4.1.9 * 2.2e-15 32.9 %
:HMM:PFM   23->69 PF00440 * TetR_N 4.6e-18 38.3 47/47  
:HMM:PFM   103->145 PF08820 * DUF1803 0.00092 21.4 42/94  
:BLT:SWISS 14->81 UIDR_SHIFL 8e-04 26.5 %
:BLT:SWISS 59->182 NUOD_METFK 3e-05 30.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56274.1 GT:GENE ACV56274.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2723445..2724107) GB:FROM 2723445 GB:TO 2724107 GB:DIRECTION - GB:PRODUCT transcriptional regulator, TetR family GB:NOTE PFAM: regulatory protein TetR; KEGG: afw:Anae109_3241 TetR family transcriptional regulator GB:PROTEIN_ID ACV56274.1 GB:DB_XREF GI:257475954 InterPro:IPR001647 LENGTH 220 SQ:AASEQ MRNHKTPAGETAGSERRDARGRLMSCAVAEFMEKGFAGASLRSIAAAADMTTGAIYGYFSGKEALFDAVVAPAADELYARYEGAQDRFYEQPLEAQTFERMRVYEERMMHDLLDFVYDNRDAFVLVFARSAGTAWERYLDRFIELEVRSTARYVREMREHGIGVVEPTPEMSRILAGMFFRGYFEPLLLGLSREAAHAFVADFERFFHAGYETIMSPQPS GT:EXON 1|1-220:0| BL:SWS:NREP 2 BL:SWS:REP 14->81|UIDR_SHIFL|8e-04|26.5|68/196| BL:SWS:REP 59->182|NUOD_METFK|3e-05|30.4|115/417| SEG 37->48|agaslrsiaaaa| BL:PDB:NREP 1 BL:PDB:REP 18->81|3dcfB|3e-04|31.2|64/181| RP:PDB:NREP 1 RP:PDB:REP 20->209|1bjzA|6e-09|11.2|178/194| HM:PFM:NREP 2 HM:PFM:REP 23->69|PF00440|4.6e-18|38.3|47/47|TetR_N| HM:PFM:REP 103->145|PF08820|0.00092|21.4|42/94|DUF1803| RP:SCP:NREP 2 RP:SCP:REP 20->82|1z77A1|1e-07|23.8|63/75|a.4.1.9| RP:SCP:REP 67->179|1b8dA|1e-04|15.4|104/164|a.1.1.3| HM:SCP:REP 12->87|2fd5A1|2.2e-15|32.9|76/0|a.4.1.9|1/1|Homeodomain-like| OP:NHOMO 23 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------154-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------33------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 97.7 SQ:SECSTR #####cTccccccccHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHcTTccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTHHHHHHTccccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHcccHH PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccc //