[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56287.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:310 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56287.1 GT:GENE ACV56287.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2740606..2741538) GB:FROM 2740606 GB:TO 2741538 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56287.1 GB:DB_XREF GI:257475967 LENGTH 310 SQ:AASEQ MQTGYFNAAWQDIKNSPGWFGKLVLLSLLSLIPIFGWLVVLGYLYGWARDIAWNVHGPLPKRIFGNEDGKLYSRGFFAMVIGFVCMLAPWILEAVWGAITGMGTAWSGRGHGGLFMFVGLSTMIFSLLIIAASFFATLFSWVGSMRMSVYGRLGAGFQFGKVWAMIRHDFSGLLRILGMAIVLAVVIGIVVSILIFVLVLIGLFIGFAMTGGNLNIQSSHPGAAVWAIVFATGGIILVFAVLCGILSTGMYVFVEMMIVRALGYWTRQFDVPAWRGQDDPMPFELAGAAGYPPVQQPPHVPPTGQPPAQG GT:EXON 1|1-310:0| TM:NTM 5 TM:REGION 21->43| TM:REGION 78->100| TM:REGION 115->137| TM:REGION 180->202| TM:REGION 232->254| SEG 23->31|lvllsllsl| SEG 181->207|ivlavvigivvsilifvlvliglfigf| SEG 292->309|ppvqqpphvpptgqppaq| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111---------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,53-53,95-95,101-102,104-104,109-109,143-144,146-146,151-151,157-157,199-200,202-202,207-207,249-249,263-263,310-311| PSIPRED ccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEcccccccccccccccccccccccccc //