[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56328.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:HMM:PFM   5->60 PF01292 * Ni_hydr_CYTB 2e-07 32.1 56/182  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56328.1 GT:GENE ACV56328.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2788032..2788310) GB:FROM 2788032 GB:TO 2788310 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV56328.1 GB:DB_XREF GI:257476008 LENGTH 92 SQ:AASEQ MALDAALLVALSTVFVSGLGMSGAVLQAFGLYAEGYYTWSPLHAAAAKALFALLLVHMAVHAGSLYNLLKRRGVAKAAAHDDGGFDDERRSV GT:EXON 1|1-92:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 42->64| SEG 42->55|lhaaaakalfalll| HM:PFM:NREP 1 HM:PFM:REP 5->60|PF01292|2e-07|32.1|56/182|Ni_hydr_CYTB| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcc //