[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56333.1
DDBJ      :             band 7 protein
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  570/915 : Eukaryota  170/199 : Viruses  1/175   --->[See Alignment]
d.43.2
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   134->293 3bk6A PDBj 2e-11 23.1 %
:RPS:PDB   133->294 3bk6A PDBj 8e-25 35.2 %
:RPS:SCOP  133->255 1winA  d.43.2.1 * 2e-17 16.3 %
:HMM:SCOP  124->258 1winA_ d.43.2.1 * 1.4e-33 35.1 %
:RPS:PFM   97->269 PF01145 * Band_7 1e-21 35.5 %
:HMM:PFM   97->268 PF01145 * Band_7 4.7e-35 33.9 171/179  
:BLT:SWISS 93->310 Y1420_ARCFU 1e-28 32.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56333.1 GT:GENE ACV56333.1 GT:PRODUCT band 7 protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2793750..2794754) GB:FROM 2793750 GB:TO 2794754 GB:DIRECTION - GB:PRODUCT band 7 protein GB:NOTE PFAM: band 7 protein; SMART: band 7 protein; KEGG: bid:Bind_3454 band 7 protein GB:PROTEIN_ID ACV56333.1 GB:DB_XREF GI:257476013 InterPro:IPR001107 InterPro:IPR001972 LENGTH 334 SQ:AASEQ MKRDKRAGAEAGVGPTGFSTGAMPAYSDGRGAPDGIRSVTNRSRASRNGAVVFAVVVFVLAFGIVLAAAQAAFAEIGLVALVSAAIVGWLASSSVHIVLEWEKAVVLRFGKFNRVAGPGLVFTWPIIEFYTLRIDQRVATTYFGAEETLTSDLVPINVDAVLFWMVFSAKKACVEVEDYSAAVAWVAQTAMRKAIGRATVAEVAMRRDQLDAELKDAIEEKLSPWGIDIIDVEVRDIVVPKELQEAMAMEAVAERKKNARMVLAEAEKDISEMLKDASEVYAGDQDAMKLRTMHLAYESVEQSGGTLVIPSAFSEGFAPEAGGAATAGRPAAGE GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 93->310|Y1420_ARCFU|1e-28|32.3|217/249| TM:NTM 3 TM:REGION 48->70| TM:REGION 75->97| TM:REGION 148->169| SEG 49->69|gavvfavvvfvlafgivlaaa| SEG 227->239|idiidvevrdivv| SEG 312->333|afsegfapeaggaatagrpaag| BL:PDB:NREP 1 BL:PDB:REP 134->293|3bk6A|2e-11|23.1|160/170| RP:PDB:NREP 1 RP:PDB:REP 133->294|3bk6A|8e-25|35.2|162/170| RP:PFM:NREP 1 RP:PFM:REP 97->269|PF01145|1e-21|35.5|172/183|Band_7| HM:PFM:NREP 1 HM:PFM:REP 97->268|PF01145|4.7e-35|33.9|171/179|Band_7| RP:SCP:NREP 1 RP:SCP:REP 133->255|1winA|2e-17|16.3|123/143|d.43.2.1| HM:SCP:REP 124->258|1winA_|1.4e-33|35.1|134/0|d.43.2.1|1/1|Band 7/SPFH domain| OP:NHOMO 1329 OP:NHOMOORG 802 OP:PATTERN 111-211111111111111211-111111121--2111111111111121111121222211111--- 11212-1111111112211-11111211111-23331333121-11111--1112111--22221132331---------72211111------11--------11-12----------------21111111111111111111111121111111----1111112222-1-----2----1-1----11--111111111111111------111--------------1------------------------------------------------------------------------------------------1--211111122121-111111111-------1-----2221---111---1-1111-----2-211111111111111111-111---1--2-1221-111121211222122111111111111--------211--11-----------111111111111111-----11-2-122123332321111122222222122232222--2221111112222121111111111111-111111122--1221122221-3221112212222211211--1-------1--------1--111111-112-11232222323222232332321-11112------11111111111111111-111111111111111111111111111111-1111111111-1111111111-111111111111--1211111111111111---111-----111111111111111111112112222221------------11112111112221111-1-111111111--1-222222--------2-1-------------------------1121111111--- 11--341-311-22222222222222222222222222221122121222222222222222212----2--122---------2--1-221221111111-1335-13168C45851223444773445P4-4464423423441412244243432548CB5341B335AE5411119---11112322-2121111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 162 STR:RPRED 48.5 SQ:SECSTR ####################################################################################################################################ccccccEEEEEEEEEEEcTTccEEEEEEEEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHTccHHHHHHcHHHHHHHHHHHHHHHTGGGTEEEEEEEEEEEEccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTHHHHHHTT######################################## DISOP:02AL 17-17| PSIPRED ccccHHcccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccEEEEEEccEEEEEEccccEEEccccEEEEEEEEEEEEEEEccccccccccccEEEEEEEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHcccccccccc //