[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56337.1
DDBJ      :             6-phosphogluconolactonase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  291/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
b.68.6b.69.10b.69.2
:352 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   14->348 3fgbB PDBj 2e-24 28.8 %
:RPS:PDB   226->332 1c5kA PDBj 2e-05 19.0 %
:RPS:SCOP  194->316 1jmxB  b.69.2.2 * 1e-10 21.8 %
:RPS:SCOP  294->337 1v04A  b.68.6.2 * 4e-05 27.3 %
:HMM:SCOP  7->350 1jofA_ b.69.10.1 * 7.3e-25 24.4 %
:RPS:PFM   24->331 PF10282 * Muc_lac_enz 1e-45 42.3 %
:HMM:PFM   12->350 PF10282 * Muc_lac_enz 1.2e-77 36.4 335/345  
:BLT:SWISS 13->348 YKGB_BACSU 5e-29 30.0 %
:REPEAT 2|157->247|258->344
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56337.1 GT:GENE ACV56337.1 GT:PRODUCT 6-phosphogluconolactonase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2797116..2798174 GB:FROM 2797116 GB:TO 2798174 GB:DIRECTION + GB:PRODUCT 6-phosphogluconolactonase GB:NOTE KEGG: bph:Bphy_2090 6-phosphogluconolactonase GB:PROTEIN_ID ACV56337.1 GB:DB_XREF GI:257476017 LENGTH 352 SQ:AASEQ MSADAAPALRRLFVGSYTDGADRGGIRTIAFDESGDEAHVVRADSCGANPTYLAQRGSLLFAAHELDSCGRMAAYAIEPDGSLTCRGACTAPYDAGTCFVLPDPNGRNLFGANYLSGSVACCALLDDGRLAAGVPSRRHEGRGLRDDRQEGPHVHSLSFVPGTRLLVAVDLGLDALVIYQVDACGMLAPTAAETVRVPAGSGPRMVAYHPRLPMAALVNELACDVLVFRIDEGGLHWRIVEQLSLPQAPSGDALAAHIAFSPDGRQLYASVRGSDQLVVFPVDDQGRVAGRCDVASGGKGPRHFSPSPDGRFLAVANLASDDVRLFERDADGMLRAVACVDVPQPACVIWNA GT:EXON 1|1-352:0| BL:SWS:NREP 1 BL:SWS:REP 13->348|YKGB_BACSU|5e-29|30.0|330/349| NREPEAT 1 REPEAT 2|157->247|258->344| SEG 165->177|llvavdlgldalv| BL:PDB:NREP 1 BL:PDB:REP 14->348|3fgbB|2e-24|28.8|326/347| RP:PDB:NREP 1 RP:PDB:REP 226->332|1c5kA|2e-05|19.0|105/397| RP:PFM:NREP 1 RP:PFM:REP 24->331|PF10282|1e-45|42.3|293/311|Muc_lac_enz| HM:PFM:NREP 1 HM:PFM:REP 12->350|PF10282|1.2e-77|36.4|335/345|Muc_lac_enz| RP:SCP:NREP 2 RP:SCP:REP 194->316|1jmxB|1e-10|21.8|119/339|b.69.2.2| RP:SCP:REP 294->337|1v04A|4e-05|27.3|44/332|b.68.6.2| HM:SCP:REP 7->350|1jofA_|7.3e-25|24.4|311/0|b.69.10.1|1/1|3-carboxy-cis,cis-mucoante lactonizing enzyme| OP:NHOMO 370 OP:NHOMOORG 316 OP:PATTERN ---------------------------1---------------------------------------- 2-2-2---------------------------------1------1--111111---1--11--1-22221---------1-------1121--------12-1-2-2-1-----------------------------------------------------------------------------------11111111111111111-1111112----2--111111-2-11111111111111111111-111112111111111111211111-------1--11111111111-------------111---1111---11-------1-1-----1111--------------------------1-2-----------111---------------------------1------------------1------------11111111-11---------------------------------------------222112211111112111111111------112-----1-1-2----------------------------------------------------1-----------------------------1----1-------------------------------------1111-211111111111-1111111111111--11-1222111111111111111111111211111111-2111111-1111--1------------------------------111111----1-11111112-11111222-------------------11111----------------------------------1------------------------------------2- ------2-----------------1--------1111111--1-------1-----1--------------------------------------------1-1-1-12----------------------------------------------------------------------2---------1-1--5445- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 96.9 SQ:SECSTR ##########EEEEEEccccEcccEEEEEEEcTTTccEEEEcEEEEccccccEEEcccEEEEEEccccTTcEEEEEEEETTTTEEEEEEEEEccccEEEEEEETcccEEEEEETTTTEEEEEEccTTcccccccEEEEcccccccTTTcccccEEEEEEcTTccEEEEEETTTTEEEEEEEcTTccEEEEEEEEEEccTTccEEEEEEcTTccHHHHHHHTTEEGEEcTTcccEEEEEETTTccEEEEEcccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTTccEEEEEcccccccEEEEEEcTTccEEEEEEcTTcccEEEEEETTcEEEEEEEEccccccccEEc# PSIPRED ccccccccEEEEEEEEEEcccccccEEEEEEcccccEEEEEEccccccccEEEEccccEEEEEEcccccEEEEEEEEcccccEEEEEEEEEccccccEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEEEccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEEEEEEEEEcccccccEEEEcccccEEEEEEccccEEEEEEEEcccEEEEEEEEEEcccccccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEEcccccccEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEcccccccEEEEEEEc //