[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56342.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  515/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:208 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->207 2vpyB PDBj 1e-28 50.3 %
:RPS:PDB   66->179 1a6lA PDBj 4e-11 21.7 %
:RPS:SCOP  3->207 1ti2B2  d.58.1.5 * 1e-44 30.9 %
:HMM:SCOP  1->207 1q16B_ d.58.1.5 * 2e-67 49.4 %
:HMM:PFM   8->26 PF00037 * Fer4 0.00025 42.1 19/24  
:HMM:PFM   73->82 PF00037 * Fer4 0.00013 90.0 10/24  
:HMM:PFM   94->111 PF00037 * Fer4 2.2e-09 50.0 18/24  
:BLT:SWISS 27->206 HMEA_ARCFU 6e-31 44.1 %
:PROS 99->110|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56342.1 GT:GENE ACV56342.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2801357..2801983) GB:FROM 2801357 GB:TO 2801983 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: eba:ebA5630 molybdenum enzyme, medium subunit,related to phenylacetyl-CoA: acceptor oxidoreductase GB:PROTEIN_ID ACV56342.1 GB:DB_XREF GI:257476022 InterPro:IPR001450 InterPro:IPR017900 LENGTH 208 SQ:AASEQ MAERLGMVIDMKGCVACASCAVACKVENNLPDGVWWNRILTDGGDNPDTPAGAYPNLTMENIAVACQHCENPACVKVCPVGATYKDPETGAVRQDYDKCIGCRMCMSACPYTGVRSFNWEEPKHAIGHAMGDADVATHQKHVVEKCTMCWHRLAKGLQPACVEVCPGRVRFFGDFNDPESEVSRLLRERAHKQLLPERGTNPSVYYLV GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 27->206|HMEA_ARCFU|6e-31|44.1|170/269| PROS 99->110|PS00198|4FE4S_FER_1|PDOC00176| SEG 14->24|cvacascavac| BL:PDB:NREP 1 BL:PDB:REP 4->207|2vpyB|1e-28|50.3|173/193| RP:PDB:NREP 1 RP:PDB:REP 66->179|1a6lA|4e-11|21.7|92/106| HM:PFM:NREP 3 HM:PFM:REP 8->26|PF00037|0.00025|42.1|19/24|Fer4| HM:PFM:REP 73->82|PF00037|0.00013|90.0|10/24|Fer4| HM:PFM:REP 94->111|PF00037|2.2e-09|50.0|18/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 3->207|1ti2B2|1e-44|30.9|181/195|d.58.1.5| HM:SCP:REP 1->207|1q16B_|2e-67|49.4|180/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2243 OP:NHOMOORG 562 OP:PATTERN 22121321344333322-4474453113-1131----1--1---1--11-1-1-1--5252---1--- -7711-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6cQ334222---------1111111111111---------------2243333332344422333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------132-11111111-1-1211-111--1--9--12nj2345-38A11-3---1631--1------21--423-32--11111111112-2242232511----------1-1121-11212-1--31211111111311--7-2-----------------------------------122-3211212233333323444413222334211232131333324213114-1-23----------A23187557A979777B178697693-A9B9343427422112211-2-------2B2321164-111-----45886-5G9A9687AA7J8---1742------B6B999-DEEEDEDDED-DDCEEEDDEDEEDCDDDD89998521AGDFFGGGGGGFEGEFE68A8BABC--444444444444---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111--------------------------------------1--1-111-31 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 98.1 SQ:SECSTR ###cEEEEEETTTcccccHHHHHHHHHTcccTTccETTTccccccccccHHHHHHHHHEEEEHHTGTTTcccHHHHHcTTccEEEcccTTcEEEcTTTcccccccTTTcTTccEEEccccTTGGGcEEEEcccEEEGGGccGGGTHHHHHHHHHHTTcccccccccccTTHHHHTTcccGGcccHHHHHcccccHHHHHHHccGGGE# PSIPRED ccEEEEEEEEccccccccHHHHHHHHHHcccccccEEEEEEEcccccccccEEEcccEEEEEEEcccccccccHHHccccccEEEcccccEEEEcHHHcccccccHHccccccEEEEccccccccccccccccccccccccEEEEccccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHHcccEEccHHHcccccEEEEc //