[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56350.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  126/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1
:184 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->63 2iu5B PDBj 5e-07 39.2 %
:RPS:PDB   8->180 2dg7A PDBj 1e-12 13.4 %
:RPS:SCOP  5->75 1rktA1  a.4.1.9 * 3e-09 12.7 %
:HMM:SCOP  6->81 2fd5A1 a.4.1.9 * 2.9e-12 31.6 %
:HMM:PFM   20->62 PF00440 * TetR_N 1.9e-08 25.6 43/47  
:HMM:PFM   93->111 PF12451 * VPS11_C 0.00055 52.6 19/49  
:BLT:SWISS 13->152 Y570_HAEIN 9e-07 30.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56350.1 GT:GENE ACV56350.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2809648..2810202 GB:FROM 2809648 GB:TO 2810202 GB:DIRECTION + GB:PRODUCT transcriptional regulator, TetR family GB:NOTE PFAM: regulatory protein TetR; KEGG: bha:BH0719 TetR/AcrR family transcriptional regulator GB:PROTEIN_ID ACV56350.1 GB:DB_XREF GI:257476030 InterPro:IPR001647 LENGTH 184 SQ:AASEQ METGKTDRRVQYTKRALTSALIDLMRENHISKISVKALCAAADVNRSTFYAHFRNQYDLLAYIEAEALEDLKARLLADGEPRTRNVEKILEYAKENADVFLMLLDESEGGFQRQIMELAHLVDLQMSDQDAAVDADDLEYMYLFAVSGALGMLSHWLKKGTPQSPAEMSELLMSMIQHGVEERA GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 13->152|Y570_HAEIN|9e-07|30.7|140/205| BL:PDB:NREP 1 BL:PDB:REP 13->63|2iu5B|5e-07|39.2|51/177| RP:PDB:NREP 1 RP:PDB:REP 8->180|2dg7A|1e-12|13.4|172/185| HM:PFM:NREP 2 HM:PFM:REP 20->62|PF00440|1.9e-08|25.6|43/47|TetR_N| HM:PFM:REP 93->111|PF12451|0.00055|52.6|19/49|VPS11_C| RP:SCP:NREP 1 RP:SCP:REP 5->75|1rktA1|3e-09|12.7|71/81|a.4.1.9| HM:SCP:REP 6->81|2fd5A1|2.9e-12|31.6|76/0|a.4.1.9|1/1|Homeodomain-like| OP:NHOMO 219 OP:NHOMOORG 127 OP:PATTERN ---------------------------------------------1---------------------- ----------------------------------------------------------------------------11--42-------------------------------------------------------------------------------------------------------------1--22222222122222212223-223----51-2221212511112111111111131-432-1-11-3---22113311--2122222212122--1111111111122332222211221--111---2--126----------1-22-1113---1-1----2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 98.9 SQ:SECSTR ##HHHHTcccTTHHHHHHHHHHHHHHHccGGGccHHHHHHHTTccHHHHHHHcccTTGGGTTTHccccHHHHHHHHHTccTTccHHHHHTTTTTccTTHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHH PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc //