[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56367.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->143 PF04892 * VanZ 8.1e-07 22.4 76/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56367.1 GT:GENE ACV56367.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2829620..2830099) GB:FROM 2829620 GB:TO 2830099 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: bha:BH3707 acetobutylicum phosphotransbutyrylase GB:PROTEIN_ID ACV56367.1 GB:DB_XREF GI:257476047 LENGTH 159 SQ:AASEQ MRNAARALVTLGFVGICAAIFYLTAQGPTESVALSSRFDAFLKFVVAHTGSDGLLAQLVQQIPVRRIGHTGEFFAFGALASVLVIVWFSQRMSVGTMMLASLGACMAGSLFDQTHKLFVPVRHFDWKDLPFDAFGYLAAVVVVFAAYGMAKALARRREG GT:EXON 1|1-159:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 67->89| TM:REGION 92->114| TM:REGION 131->153| SEG 138->146|aavvvvfaa| HM:PFM:NREP 1 HM:PFM:REP 50->143|PF04892|8.1e-07|22.4|76/133|VanZ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-73,76-76,81-81| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //