[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56368.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:141 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   42->99 1y7yB PDBj 7e-09 41.4 %
:RPS:PDB   41->100 2axuC PDBj 4e-15 24.1 %
:RPS:PDB   73->139 1e5rB PDBj 3e-04 11.9 %
:RPS:SCOP  40->101 1b0nA2  a.35.1.3 * 3e-14 29.0 %
:HMM:SCOP  33->111 1y9qA1 a.35.1.8 * 8.6e-15 38.0 %
:RPS:PFM   45->99 PF01381 * HTH_3 2e-08 45.5 %
:HMM:PFM   45->99 PF01381 * HTH_3 8.7e-17 43.6 55/55  
:BLT:SWISS 40->100 Y4DJ_RHISN 2e-07 39.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56368.1 GT:GENE ACV56368.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2830242..2830667 GB:FROM 2830242 GB:TO 2830667 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: pol:Bpro_0338 transcriptional regulator, XRE family GB:PROTEIN_ID ACV56368.1 GB:DB_XREF GI:257476048 InterPro:IPR001387 LENGTH 141 SQ:AASEQ MYSGGYKGAYSTGYACDMGKSSEKNTPAYHDPLVQQYAFILGENLRQLRKAQGLTQERLGLMIGTGHSRISNIERGRVVPSVPDMIKLCRALEADPVELVDTAAFKLSDFPERQQGHARLYAPPPRPAEATAGPPGSSVCE GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 40->100|Y4DJ_RHISN|2e-07|39.3|61/77| BL:PDB:NREP 1 BL:PDB:REP 42->99|1y7yB|7e-09|41.4|58/66| RP:PDB:NREP 2 RP:PDB:REP 41->100|2axuC|4e-15|24.1|58/295| RP:PDB:REP 73->139|1e5rB|3e-04|11.9|67/262| RP:PFM:NREP 1 RP:PFM:REP 45->99|PF01381|2e-08|45.5|55/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 45->99|PF01381|8.7e-17|43.6|55/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 40->101|1b0nA2|3e-14|29.0|62/68|a.35.1.3| HM:SCP:REP 33->111|1y9qA1|8.6e-15|38.0|79/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 85.8 SQ:SECSTR ####################cccccccccccTTcccccTHHHHHHHHHHHHTTccHHHHHHHTTTcHHHHHHHTTTcccccHHHHHHHHHHHTccHHHHHHHHHHHHcccccHHHHHGGGcHHHHHHHHHccccTTccEEE PSIPRED ccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccccHHHHc //