[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56381.1
DDBJ      :             transferase hexapeptide repeat containing protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   107->186 1sstC PDBj 2e-07 31.2 %
:RPS:PDB   128->220 3d8vA PDBj 6e-10 22.8 %
:RPS:SCOP  121->199 1s80A  b.81.1.6 * 6e-11 29.5 %
:HMM:SCOP  119->199 1ssqA_ b.81.1.6 * 5.1e-09 32.5 %
:HMM:PFM   171->187 PF00132 * Hexapep 7.6e-06 41.2 17/18  
:BLT:SWISS 25->119 Y1313_METJA 2e-04 31.9 %
:BLT:SWISS 122->199 CYSE_SYNY3 3e-07 40.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56381.1 GT:GENE ACV56381.1 GT:PRODUCT transferase hexapeptide repeat containing protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2842524..2843201 GB:FROM 2842524 GB:TO 2843201 GB:DIRECTION + GB:PRODUCT transferase hexapeptide repeat containing protein GB:NOTE PFAM: transferase hexapeptide repeat containing protein; KEGG: hch:HCH_04824 serine acetyltransferase GB:PROTEIN_ID ACV56381.1 GB:DB_XREF GI:257476061 InterPro:IPR001451 LENGTH 225 SQ:AASEQ MPVNIVGSEAGAKAMLLKQLNSLFFISKIEEAAIDGEFGRALARCQRSFSKTRNKYYSEASATKFDPLQGCQWSRFLYELARCIFVEEGVSSVCDKLYALNKAMSSVDLYYQVAMPDIFMFDHPFGSVMGRASYSDYFTFSQGCTVGNNRGIYPRFGQSVFMFSNSKVIGDCEIGDNVIIGANAYVKDTDIPGGSLVFGQSPDLVIKENKLDYVRKYAEQVFSYE GT:EXON 1|1-225:0| BL:SWS:NREP 2 BL:SWS:REP 25->119|Y1313_METJA|2e-04|31.9|91/403| BL:SWS:REP 122->199|CYSE_SYNY3|3e-07|40.3|77/249| BL:PDB:NREP 1 BL:PDB:REP 107->186|1sstC|2e-07|31.2|80/236| RP:PDB:NREP 1 RP:PDB:REP 128->220|3d8vA|6e-10|22.8|92/478| HM:PFM:NREP 1 HM:PFM:REP 171->187|PF00132|7.6e-06|41.2|17/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 121->199|1s80A|6e-11|29.5|78/241|b.81.1.6| HM:SCP:REP 119->199|1ssqA_|5.1e-09|32.5|80/241|b.81.1.6|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 68.9 SQ:SECSTR ######################################################################EEcTTcEEccEEEEEEEEcTTcEEcccEEEcTTcEEcTTcEEEETEEEEccEEcTTcEEEcEEEccccEEccccEEEccccccEEEcTTcEEccccEEEcccEEcTTcEEcTTcEEccccccTTcEEcccccccccTTcTTTHHHHHHTcHHHHH DISOP:02AL 9-13,17-17| PSIPRED cccEEEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccEEcccEEEcccccEEEcccEEccccEEccccEEcccccccEEcccccEEccccEEEccEEEccccEEccccEEcccccccccEEEEcccEEEEEcccHHHHHHHHHHHHHcc //