[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56385.1
DDBJ      :             Spore coat polysaccharide biosynthesis protein predicted glycosyltransferase-like protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:349 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   189->261 1foeE PDBj 7e-04 26.0 %
:RPS:PDB   177->349 3d0rB PDBj 1e-11 14.9 %
:RPS:SCOP  22->349 1f0kA  c.87.1.2 * 1e-17 18.9 %
:HMM:SCOP  7->349 1f6dA_ c.87.1.3 * 4.6e-11 20.8 %
:RPS:PFM   177->290 PF04101 * Glyco_tran_28_C 3e-04 30.4 %
:HMM:PFM   209->272 PF02684 * LpxB 5.2e-06 21.9 64/373  
:HMM:PFM   21->77 PF03033 * Glyco_transf_28 0.00039 19.6 56/139  
:BLT:SWISS 8->271 Y1062_METJA 9e-18 25.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56385.1 GT:GENE ACV56385.1 GT:PRODUCT Spore coat polysaccharide biosynthesis protein predicted glycosyltransferase-like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2845957..2847006 GB:FROM 2845957 GB:TO 2847006 GB:DIRECTION + GB:PRODUCT Spore coat polysaccharide biosynthesis protein predicted glycosyltransferase-like protein GB:NOTE KEGG: ppw:PputW619_3708 GCN5-related N- acetyltransferase GB:PROTEIN_ID ACV56385.1 GB:DB_XREF GI:257476065 LENGTH 349 SQ:AASEQ MWDSSRKKVFIRTDANKVIASGHVMRCLSIADALFDLGLQVEFVMSDSCAFETIRRRGYDVSALDTDWRSIEEGADLLERKCLELSEPATILVDTYSITRPYVDRLARCAKICYLGSKRDDLGNLSLLANYSTDIDTARYEELYLKRGTALLLGPRYAPLKKRFSSLAKTPSETIDRVLLTTGSTDPHNFISEFLRAVKNSRILRSLEFEVVVGQMFEFEDEIEHLASQEDNIRLHRKVEDMAGLMATVDVAVSACGTTVYELAAVGLPVVTFAMVDEQVASAESLARLGVVAYSGLFYSSKQGVLNSAISKLEDLVATPEKAAVLATKARSLIDGKGAQRIAKELAEL GT:EXON 1|1-349:0| BL:SWS:NREP 1 BL:SWS:REP 8->271|Y1062_METJA|9e-18|25.5|251/484| BL:PDB:NREP 1 BL:PDB:REP 189->261|1foeE|7e-04|26.0|73/361| RP:PDB:NREP 1 RP:PDB:REP 177->349|3d0rB|1e-11|14.9|161/381| RP:PFM:NREP 1 RP:PFM:REP 177->290|PF04101|3e-04|30.4|112/162|Glyco_tran_28_C| HM:PFM:NREP 2 HM:PFM:REP 209->272|PF02684|5.2e-06|21.9|64/373|LpxB| HM:PFM:REP 21->77|PF03033|0.00039|19.6|56/139|Glyco_transf_28| GO:PFM:NREP 4 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF04101|IPR007235| GO:PFM GO:0016758|"GO:transferase activity, transferring hexosyl groups"|PF04101|IPR007235| GO:PFM GO:0030246|"GO:carbohydrate binding"|PF04101|IPR007235| GO:PFM GO:0030259|"GO:lipid glycosylation"|PF04101|IPR007235| RP:SCP:NREP 1 RP:SCP:REP 22->349|1f0kA|1e-17|18.9|317/351|c.87.1.2| HM:SCP:REP 7->349|1f6dA_|4.6e-11|20.8|322/0|c.87.1.3|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 74 OP:NHOMOORG 73 OP:PATTERN --------------------------------1---1----------1-------------------- --------------------------------------------------------------------------------1-------------------------1--------------------------------1-----------------------------1--1--------------------1-------------1-----11--------------------------------------------------------------------------------------------------------------111111-11-111----1----11----111-----1--------------1111-----------------------------------------------11-----------------1---------------------------------------------------------1------------------------------1-------------1--------------------1-11--1--112--1-----1--1---------1--------------------------11----1-1-------1--1--11---1------1----------------------------------------------------------------------------------------------------------1-------------------1----1---------11-----11---------------11----------------------------11-----------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 97.7 SQ:SECSTR ###cccEEEEEEEcc#####HHHHHHHHHHHHHHTTcTTTEEEEEEEcccccHHHHHHHHHHTccEEcccccTTccHHHHHHHHHHcccEEEEETTcHHHHHHHHHHHHTTccEEEEccccHHHHccEEEEccHHHHHHHHHTTccGGGEEEcccHHHHHHHHHHTcTTccTTcEEEEEEEccHHHHHHHcGGGGHHHHHHHTTccccEEEEcTEccccTcccGGGccccTTEEEccccccHHHHHTTEEEEEEccTTHHHHHHHHTccEEEcccTTccccHHHHHHHHHHTcEEEEEEccGGGccHHHHHHHHHHHHcHHHHHHHHHHHHHHHTcccHHHHHHHHHHH PSIPRED cccccccEEEEEEcccccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccEEEEccccccccccccccccccccHHHHHHcccccccEEEEcccHHcccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHccccEEEEccHHHHHHHHHHccEEEEcccHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHc //