[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56389.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->64 2rgvB PDBj 1e-04 33.3 %
:HMM:PFM   42->59 PF12212 * PAZ_siRNAbind 6.1e-05 50.0 18/47  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56389.1 GT:GENE ACV56389.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 2853238..2853516 GB:FROM 2853238 GB:TO 2853516 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dds:Ddes_1353 hypothetical protein GB:PROTEIN_ID ACV56389.1 GB:DB_XREF GI:257476069 LENGTH 92 SQ:AASEQ MGDSLIPLHYAILKHFMDGEADCADGVVRALEGDYRGYKLLNRADVEETLATAKENGLLDEAGYDLSEEGYLRIRYRINSFGEDMMGRYIAK GT:EXON 1|1-92:0| BL:PDB:NREP 1 BL:PDB:REP 2->64|2rgvB|1e-04|33.3|60/140| HM:PFM:NREP 1 HM:PFM:REP 42->59|PF12212|6.1e-05|50.0|18/47|PAZ_siRNAbind| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11111111111---------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 65.2 SQ:SECSTR #TccccHHHHHHHHHHHTcccccHHHHHHHHTTTccc###ccHHHHHHHHHHHHHTTcEEEEcc############################ DISOP:02AL 92-93| PSIPRED cccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHccccccccEEEEEEEEcHHHHHHHHHHHHc //