[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV56408.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  522/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:203 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->197 2vpyB PDBj 3e-29 40.6 %
:RPS:PDB   51->148 1bc6A PDBj 5e-10 22.7 %
:RPS:SCOP  3->197 1ti2B2  d.58.1.5 * 8e-48 36.6 %
:HMM:SCOP  1->198 1q16B_ d.58.1.5 * 8.6e-69 53.4 %
:HMM:PFM   7->22 PF00037 * Fer4 1e-06 56.2 16/24  
:HMM:PFM   83->105 PF00037 * Fer4 5.3e-12 60.9 23/24  
:HMM:PFM   154->163 PF00037 * Fer4 0.00082 70.0 10/24  
:BLT:SWISS 3->170 PHSB_SALTY 2e-33 50.7 %
:PROS 90->101|PS00198|4FE4S_FER_1
:REPEAT 4|12->41|57->80|90->110|147->169

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV56408.1 GT:GENE ACV56408.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(2872776..2873387) GB:FROM 2872776 GB:TO 2873387 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: eba:ebA5630 molybdenum enzyme, medium subunit,related to phenylacetyl-CoA: acceptor oxidoreductase GB:PROTEIN_ID ACV56408.1 GB:DB_XREF GI:257476088 InterPro:IPR001450 InterPro:IPR017900 LENGTH 203 SQ:AASEQ MAYGMLIDLKKCVGCHACAVACKEAHGTPPGITRSHVKREFEGEYPDATMHIVPMLCMHCENPPCVEACPTEGATYKREDGIVVVDKEKCIGCKSCIMACPYGARYYRENEDGYFGTELNEYEAVMYTAMPQGRVDKCTFCVDRIDAGGNEPQACVAACPAGARVFGDLETLKKQAESAAGFQLLPDEGANPSVWYLPNKVNA GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 3->170|PHSB_SALTY|2e-33|50.7|144/192| PROS 90->101|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 4|12->41|57->80|90->110|147->169| BL:PDB:NREP 1 BL:PDB:REP 3->197|2vpyB|3e-29|40.6|170/193| RP:PDB:NREP 1 RP:PDB:REP 51->148|1bc6A|5e-10|22.7|75/77| HM:PFM:NREP 3 HM:PFM:REP 7->22|PF00037|1e-06|56.2|16/24|Fer4| HM:PFM:REP 83->105|PF00037|5.3e-12|60.9|23/24|Fer4| HM:PFM:REP 154->163|PF00037|0.00082|70.0|10/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 3->197|1ti2B2|8e-48|36.6|172/195|d.58.1.5| HM:SCP:REP 1->198|1q16B_|8.6e-69|53.4|174/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2528 OP:NHOMOORG 580 OP:PATTERN 22121322344333325-5574473113-1131-533333233-1--13-21212115262---4--- -7A11-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6cS334222---------1111111111-11---------------2243333332344423333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------143-21111111-1-1411-111--1--9--13pl3354-5AB11131--1831--1------21--423-31--11111111112-2242232511----------1-1121-11212-1--31211111111311--8-3-------------------------------111-122-3311212233333324444413222334211232241443325213124-1-23----------B3418D557BA8AA77D199797693-A9B9353727422112211-2-------2B3321174-111-----46997-5H9A9787BA8K8---1842------B6D9AA-HIIGHGFFHH-HHGIHGGHGHIGHFHHHHA9AA9621CHDGGHHHHHHGFHFGG7ACBFEFG--555555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------21--11111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 96.6 SQ:SECSTR ##EEEEEccGGGGccccccTTccTTcccTTcccccccccccccccccHHHEEcccTTTTccccccTTTcTTcHHcEEEccccEEEcTTTccccccHHHHcGGGccEETTTTGGGTHTccEEEEccccccHTccHHHHHHHHHHHHHTTTcccHHHHccGGGccccEEEEcccccGGGHcccEEccTTccccccEEEEc##### PSIPRED ccEEEEEEccccccccHHHHHHHHHHccccccccEEEEEEEcccccccEEEEEEEccccccccHHHHHcccccEEEEcccccccccHHHcccccccHHccccccEEEccccccccccccccccccccccccccEEEEccccHHHHHccccccccHHHHcccccEEEEEHHHHHHHHHHcccEEccHHHcccccEEEccccccc //